KEGG   Oscillibacter valericigenes: OBV_13490Help
Entry
OBV_13490         CDS       T01636                                 

Gene name
porA
Definition
(GenBank) pyruvate synthase subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00010  Glycolysis / Gluconeogenesis
ova00020  Citrate cycle (TCA cycle)
ova00620  Pyruvate metabolism
ova00633  Nitrotoluene degradation
ova00640  Propanoate metabolism
ova00650  Butanoate metabolism
ova00680  Methane metabolism
ova01100  Metabolic pathways
ova01120  Microbial metabolism in diverse environments
ova01130  Biosynthesis of antibiotics
ova01200  Carbon metabolism
Module
ova_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_13490 (porA)
   00020 Citrate cycle (TCA cycle)
    OBV_13490 (porA)
   00620 Pyruvate metabolism
    OBV_13490 (porA)
   00640 Propanoate metabolism
    OBV_13490 (porA)
   00650 Butanoate metabolism
    OBV_13490 (porA)
  Energy metabolism
   00680 Methane metabolism
    OBV_13490 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    OBV_13490 (porA)
Enzymes [BR:ova01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     OBV_13490 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: BAK98547
UniProt: G4KT33
Position
1290160..1291338
Genome map
AA seq 392 aa AA seqDB search
MGIRERLSGNEAVALAMKQINPDVMGAFPITPSTEIPQYFSAYVDNGQVDTEFIPVESEH
SAMSTCIGAEAAGCRAISATSSCGLCYMTEMLYVAASDRLPITLAVSCRALSGPININND
HSDAMGVRDAGWLMLFAETNQEAYDNYLQAMRIGEAVGLPIMVCQDGFITSHAIENIELV
EDEKVKAFVGEYKPQHYLLNKDEPMAVGAYATPVYYMEAKRQQAQAMMDAKDVIKKVGAE
FGQMTGRTYGMIEKYEMDDAEEAIVIIGSSAGTAKEAVNELRAQGKKVGLVKVRAFRPFP
AEEICEALKNVKSFAVMDKDDSFNGHCGPMYAEVTASLYAAGVSAPRGISYIYGLGGRDV
RVESIQRVFGELGEIAKTGVTGETYRYLDVRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggcatccgagaaagactttccggcaacgaggctgttgccttggcaatgaaacagatt
aaccccgacgtcatgggcgcatttcccatcaccccgtccaccgagatcccccagtatttt
tctgcatatgtggataacggacaggtggacacggagtttatccctgtggagtccgaacac
tccgccatgtccacctgtattggcgcggaggccgccggctgccgcgcgatttccgccacc
tcctcctgcggcctttgctacatgactgagatgctgtacgtggcggcttccgaccgtctt
cccatcacgctggcggtttcctgccgcgccctgtccggccccatcaacatcaacaacgac
cactccgacgccatgggcgtccgggacgcgggctggctgatgctgttcgccgagacgaat
caggaggcgtacgacaactacctgcaggccatgcgcatcggcgaggccgtaggtcttccc
atcatggtgtgccaggacggcttcatcacctcccacgccattgaaaatatcgagctggtg
gaagatgagaaggtcaaggcgttcgtgggcgagtacaagccccagcactacctgctgaac
aaggacgaacccatggccgtgggcgcttatgccacccccgtgtactatatggaggccaag
cggcagcaggcccaggccatgatggacgcgaaggacgtcatcaagaaggtgggcgcggag
ttcggccagatgaccggccgcacctatggaatgatcgagaagtacgagatggacgacgcc
gaggaggccatcgtcatcatcgggtcctccgccggtaccgccaaggaggctgtaaacgag
ctgcgggcacagggtaaaaaggtgggtcttgtcaaggtccgcgccttccgtcctttcccc
gccgaggagatttgtgaggctctaaagaacgtgaagtcctttgccgtcatggacaaggac
gacagcttcaacggccactgcggccccatgtacgccgaggtcaccgcatctctgtacgcc
gcaggcgtcagcgcccccaggggcatcagctatatttatggtctgggcggccgggacgtg
cgggtggagagcatccagcgcgtcttcggcgagctgggcgagatcgccaaaaccggcgtc
acgggcgagacctaccgctatctggacgtgcgggaataa

DBGET integrated database retrieval system