KEGG   Oscillibacter valericigenes: OBV_14940Help
Entry
OBV_14940         CDS       T01636                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ova  Oscillibacter valericigenes
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OBV_14940 (gpmA)
   01230 Biosynthesis of amino acids
    OBV_14940 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_14940 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    OBV_14940 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OBV_14940 (gpmA)
Enzymes [BR:ova01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OBV_14940 (gpmA)
Exosome [BR:ova04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OBV_14940 (gpmA)
  Exosomal proteins of melanoma cells
   OBV_14940 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434828..1435574
Genome map
AA seq 248 aa AA seqDB search
MKTLVLLRHGESEWNLKNRFTGWTDVDLSEKGAEEAKSAGNALKKAGYDFDLCYTSYLKR
AIHTLNYALGEIDREWLPVIKSWKLNERHYGALQGLNKSETAIKYGEKQVQIWRRSFDVE
PPRLKPEDERNPARQQQYREVPREVLPLTESLRDTVTRVVPYYTQKILPQIQDGKRVLIA
AHGNSLRALIMTFENLSAEQIADVNVPTGIPLIYEFTKDAQVHRKFYLGDPAVIEMKMEA
VAPQGKAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagacacttgtactgctccgccacggggagagtgaatggaatctgaaaaaccgtttt
accggctggacggacgtggacttatccgaaaaaggcgcggaggaggcaaagagcgccggc
aatgccctaaagaaagccgggtacgactttgacctctgctatacatcgtatctcaagcgt
gccattcatacgctgaattacgcactgggcgagatagatcgagaatggctgccagtcatc
aaaagctggaaactcaatgaacggcattacggtgcgctgcagggactgaataagtcggaa
acggcgattaagtacggagagaagcaggtgcagatctggcgcagatcatttgatgtggaa
ccaccccggctgaaaccggaggatgagagaaacccggcccggcagcagcaataccgtgag
gttccccgtgaggtgcttcctttgactgagagcctgcgggacacggttacgcgggtagtc
ccatattatacgcagaagattctgccccagatacaagatgggaagcgcgttctcatcgcc
gcccacggcaattcgctgcgcgcactcattatgacgttcgagaacttaagcgcggagcag
attgcggatgtcaacgttcccacagggatcccactgatttatgagtttacgaaggatgca
caggtgcataggaaattttatctgggcgacccggctgtgatcgagatgaagatggaggca
gtcgctccgcagggaaaagcaaagtaa

DBGET integrated database retrieval system