KEGG   Oscillibacter valericigenes: OBV_16540Help
Entry
OBV_16540         CDS       T01636                                 

Gene name
adhE
Definition
acetaldehyde dehydrogenase/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ova  Oscillibacter valericigenes
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OBV_16540 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_16540 (adhE)
   00620 Pyruvate metabolism
    OBV_16540 (adhE)
   00650 Butanoate metabolism
    OBV_16540 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    OBV_16540 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    OBV_16540 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OBV_16540 (adhE)
   00626 Naphthalene degradation
    OBV_16540 (adhE)
Enzymes [BR:ova01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OBV_16540 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     OBV_16540 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1593486..1596257
Genome map
AA seq 923 aa AA seqDB search
MANALLINSVESFEQALPIIRASQEQYATFTQEQVDTICEKAAMAVSKMRIPLAKMACEE
TGYGIVVDKVTKNQYASEHMWNYMRHAKTCGIIEENPAFGTKRVASPKGVIAAVTPTTNP
TSTTIFKMMVALKTRNAIILSPHPHAVKCSIAAARIMRDAAIEAGLPEHVISWIETPSLE
ISDVLMKKVDLIMATGGAGMVHAAYSSGTPAIGVGPGNCNVVIDETADLRMAVESIVHSK
TFDNGMICATEQHITVLSSVYDEVKALLKDARCYFLNDEEAPKVAKVFFNPKNHGVNPPA
VGQTAVRLAEMAGIQVPYDTKVLIYETNDTSHDNPWANEKLTTLLGMFKADTLDEAFDIC
AKVVFEGGAGHSAAMYVDPTEEDKINRFAEKMKAGRILINTPTAFGGIGDLYNFDIAPSL
TLGPGSVGHSAYMGNTNFEQLLDIKVVAIRKENLLWLQLPKKVYHKTGCTPVALREMKHV
YDFQRAFIITDANLYQIGACDSILNQLHDLGIETAEFFDIRVDPQIQDAMKGLPKMNEFE
PDVIIAVGGGSAIDTAKIMWIMYEHPEEAFLDMATTFLDIRKRIRFFPQMGKKAKLVCIP
TTAGTGSECTPFTIISDANTGMKWPLIGYEMMPEMAIIDADHMMKLPPRATQASGYDVLT
HAVEAYVSTFATEYTDGFCRDATRMVFNYLPRAYRSAFKGAKADPVAREKMADASCLAGI
GFANAFLGINHSLSHKIGGWFHIPHGTANALLFPYVCRFNAQKHPYHMGTFSQYKYPQAF
ERYVELGELIGVKGATDEETFENWIKAAEQLKKDVDIPETICDWLVEAHPEKSAQVWEAE
FLAAVDQMSEWAFHDACTGCNPVYPTIDELKACYLRAFYGNEKFVEKFGDVLEVKATLPL
DTHASYPMGLSAEIGIDKVGGFI
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgcattattgatcaactcagtagaatcgtttgagcaggctctgcccatcatt
cgcgcttctcaggagcagtatgccacctttacacaagaacaggtggatactatctgcgaa
aaggccgccatggcggtatccaagatgcggattccccttgccaaaatggcctgtgaggag
accggttacggtatcgttgtggacaaggtaacgaagaatcaatatgcttctgagcatatg
tggaactatatgcgtcacgccaaaacctgcggtatcattgaggagaaccccgctttcggc
accaaacgagtggcctctcccaagggtgtaattgccgctgttactcctaccaccaacccc
acttctaccacaatttttaagatgatggtagccctgaaaaccagaaatgccatcatcctc
tccccacatccccatgctgtgaaatgctctatcgccgccgcgagaattatgcgggatgcc
gctattgaggcgggccttccggaacacgtgatcagctggatcgagacaccttctctggaa
atttccgatgtattgatgaagaaagttgacttgattatggctaccggcggtgccggcatg
gtccatgcagcctattcttccggtacgcccgccatcggcgtgggccccggcaactgtaac
gtcgtaatcgacgagacggcagacctccgtatggctgtggagtccatcgttcattccaag
acgtttgataatggtatgatctgtgccacagagcagcatatcacggtactgagcagcgtt
tatgatgaggtcaaggcgttactgaaagatgcccgctgctatttcctgaacgacgaagag
gctcccaaggtggccaaggtgttcttcaatcccaaaaatcacggcgtaaatccccccgcc
gttggtcagaccgccgtgcgacttgccgagatggccggaattcaggtgccctatgatacc
aaggttctgatctacgagacgaacgatacctcccacgataacccctgggccaatgagaag
ctgaccactttgctgggcatgtttaaagccgacaccctggatgaggccttcgacatctgc
gccaaggtagtctttgagggtggcgcgggccactctgcggcaatgtacgttgaccccaca
gaggaagataagatcaaccgcttcgctgaaaaaatgaaggccggtcgtatcctcatcaat
acacccacggctttcggtggtatcggcgatctgtacaacttcgatattgcaccgtctctg
actctggggccgggctccgtgggtcactctgcctacatgggaaacaccaatttcgagcag
ctgctggatatcaaagtcgttgccatacgcaaggaaaatctgctgtggctccagctgccc
aaaaaagtttatcacaagacaggctgcactcccgtggctttgcgggaaatgaagcacgta
tacgattttcagcgtgcctttatcatcaccgatgccaacctctatcagatcggtgcctgt
gacagcattctcaaccagctgcatgatctgggtattgaaaccgccgagttctttgatatc
cgcgtggacccgcagattcaggacgccatgaagggtctgcctaagatgaacgaattcgag
cctgatgtcatcatcgctgtgggcggcggctccgcaatcgataccgccaagattatgtgg
atcatgtatgagcatcccgaagaggcatttttggacatggccaccaccttcctggatatc
cgcaagagaattcgctttttcccacaaatgggcaagaaggcaaagctggtgtgtatcccc
accacagccggtaccggctccgagtgcacgccctttaccatcatctccgatgccaacacc
ggtatgaagtggccgctgatcggatatgaaatgatgcccgagatggccatcatcgatgcg
gaccatatgatgaagctgccgccaagagcgacacaggcctccggctatgacgtgctgact
cacgccgtggaagcctacgtttccaccttcgccactgagtataccgacggcttctgtagg
gatgccaccaggatggtgttcaattatctgccgcgggcctatcgctccgcgttcaagggc
gcgaaggcagatcccgttgcccgtgagaaaatggctgatgcttcctgcctggctggcatt
ggtttcgccaacgcattcctcggtatcaaccactccctgtcccacaagattggcggttgg
ttccatatcccccacggaaccgccaacgcgctgctgttcccctatgtctgccgctttaat
gcccagaagcacccctatcatatggggactttctcgcagtataaatatccccaggcattt
gagcgctatgtcgagctgggtgaacttattggcgtcaagggtgctacggatgaagaaacc
tttgaaaactggatcaaggctgccgagcagctgaaaaaggatgtggacattcccgagacg
atctgcgactggctggtggaagcccatcctgagaagagcgcgcaggtgtgggaagcagaa
ttcctggccgctgtcgaccagatgtcggaatgggcgttccacgacgcatgcaccggctgc
aatcctgtatatcccaccatcgacgagctgaaggcctgttacttgagagccttctacgga
aacgagaagttcgttgaaaagttcggcgatgttctggaagtgaaggccacgctgcccctc
gatacgcacgcgtcttatcccatgggcctctccgcagaaatcggtattgacaaggtcggc
ggtttcatttga

DBGET integrated database retrieval system