KEGG   Oscillibacter valericigenes: OBV_19420Help
Entry
OBV_19420         CDS       T01636                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ova  Oscillibacter valericigenes
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ova00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1838298..1839443
Genome map
AA seq 381 aa AA seqDB search
MTKTISLLGSTGSIGRQTLDVAEQLGLSVAALTARGGNLDLLERQTRQFLPRLVALYDPA
AAEEFSGRVKDLNVKVASGPEGLLAAAAIGDADTVVTAVVGMVGLRPTLAAIEQGKRIAL
ANKETLVCAGELVMDAADRYGAEIVPVDSEHSAIFQCLRGCEDRGEIRRLFLTCSGGPFL
GRKFEELEGVTRKDALQHPNWKMGPKITVDCATLMNKGLEVIEAMRLYRLPLAQVDVLIH
RQSIVHSMVEYRDGAVLAQMGTPDMRLPIRYAFTYPGRGENWAEPLDLLSCPPLTFAAPD
REAFPCFGLAEAAAEEGGTACAVLSGANEAAVGLFLQDKIGFNDISRLVKKAREAVPVVY
HPTLADILKADAAARRAVLPE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacgatttcacttttgggttccaccggttccattggacggcagacgctggat
gtggcggaacaattgggactctccgtggcggcactgaccgcccgcggagggaatctggac
ttactggagcggcagacgcggcagtttctgccgcgtcttgtggcgttgtacgaccctgcg
gccgcagaggaattcagcggacgtgtcaaagatctgaacgtaaaggttgcctccggcccg
gagggattgctggcggcggcggcaatcggggatgcggacacggtggttaccgccgtggtg
ggcatggtgggacttcggcccacactggctgccatcgagcagggaaaacgcatcgcgctg
gccaacaaggagacgctggtgtgcgccggggaactggtgatggatgcggcggaccgatac
ggggcggagatcgttccggtggattcggagcactccgccatcttccagtgcctgcgtgga
tgcgaggaccgaggggagatcagacgcctctttctgacctgctccggcggtccgtttctc
ggcagaaaatttgaggaactggaaggcgtgacaaggaaagacgcattacagcatcccaac
tggaaaatgggccctaaaattacggtggactgtgccactctcatgaataagggactggag
gttattgaggccatgcggctctatcgcctgcccctcgcgcaggtggatgtgctgattcac
cggcagagcatcgttcactccatggtggagtaccgggatggggcggtgctggcccagatg
gggacgccggatatgcgtctccccatccgatacgcgttcacgtatcccgggcggggggag
aattgggcggagccgttggaccttttaagctgtccgccgctgaccttcgccgcgccggac
cgggaggcattcccctgctttgggctggcggaagccgctgcggaagagggcggaaccgcc
tgtgccgttctcagcggagccaacgaggcggcggtgggcctgtttttgcaggataagatt
ggctttaatgatatttcccggctggtaaaaaaggcgcgggaggccgtcccggtggtatat
catccaacccttgcggatattctgaaagcagacgccgctgcccggcgtgctgttctcccg
gagtga

DBGET integrated database retrieval system