KEGG   Oscillibacter valericigenes: OBV_20240Help
Entry
OBV_20240         CDS       T01636                                 

Definition
putative lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ova  Oscillibacter valericigenes
Brite
Enzymes [BR:ova01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     OBV_20240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1913387..1913842
Genome map
AA seq 151 aa AA seqDB search
MFTLAKQERTTGPAGLALIKQFEGCRLKAYKPFSYEKYWTIGWGHYGADVAQGQTITQAQ
ADAMLVADLKKYEASVRNAAYCPITAQLTQNQFDALVSFTYNCGGGCLKTLCKDRTAAQI
AAKLPLYNKSGGRAIAGLTRRRMAEQALFNK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgttcacgctggcgaaacaggagcgcactaccggcccggcagggctggccctcatcaag
cagtttgagggctgccgcctgaaagcgtacaagccgtttagctatgagaaatactggacc
atcggctggggccactacggcgcggacgtcgctcagggccagacgatcacccaggcgcag
gcggacgccatgctggtggcggatctgaagaagtatgaggcgtccgtccggaatgcggcg
tactgccccatcactgcccagctgacgcagaaccagtttgacgcgctggtgagctttacg
tacaactgcgggggcgggtgtttgaagacgctttgcaaggaccgcacggcggcgcagatc
gcggcgaagctgccgctctataacaagagcggaggcagggccattgcggggctgacgagg
agaaggatggcggagcaggcgctgtttaataagtag

DBGET integrated database retrieval system