KEGG   Oscillibacter valericigenes: OBV_20790Help
Entry
OBV_20790         CDS       T01636                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ova  Oscillibacter valericigenes
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OBV_20790 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_20790 (glk)
   00052 Galactose metabolism
    OBV_20790 (glk)
   00500 Starch and sucrose metabolism
    OBV_20790 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    OBV_20790 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OBV_20790 (glk)
   00524 Butirosin and neomycin biosynthesis
    OBV_20790 (glk)
Enzymes [BR:ova01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     OBV_20790 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1966134..1967075
Genome map
AA seq 313 aa AA seqDB search
MYVGIDVGGTNLKAGLVDEAGRLLATRKIPLGMFQGEEYFVRKLAELTAQVSRDGGVIPG
ELEYVGMGIPGAVAEGDILYTCNIPLQNVPIGRLFSQYLDVPVMLENDANCAAVGEYFRG
AGQGTKDFAVVTLGTGIGGGFILGGKLYAASGMAGEVGHMVVEKGGVLCNCGRRGCWEAY
ASATGLIRMTKETMERARESLLWEESKGGSAVSGRTAFAAALRGDRTAKALCETYVEYLA
AGIVNLLNILQPEVLAIGGGISEAEDELLLTPLKEIVDRESYAAHCGGKATVVKAELGND
AGMIGAALLKRAI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtaggaatcgacgtaggcggtacgaatctgaaggcgggcctcgtggacgaggcg
ggccgtcttctggcgacccgaaaaattcctctgggtatgtttcagggcgaggaatatttt
gtccgtaagctggcggagctgacggcgcaggtctcgcgggacggcggcgtgattcccgga
gagctggaatatgtgggcatgggtattcccggcgcggtggcggagggggatatcctatac
acctgcaacattccgctgcaaaacgtccccatcggcagactgttcagccagtatctggac
gttccggtgatgcttgaaaacgacgccaactgcgccgctgtgggcgagtattttcgcggc
gcgggacaggggacaaaggactttgccgtagtgactttgggcacgggcatcggcggtgga
ttcattctgggcggcaaactttacgccgccagcggcatggccggcgaagtggggcatatg
gtggtggaaaagggcggcgtactctgtaactgcgggcggcgcggctgctgggaggcatat
gcctccgccaccggactgattcgcatgacgaaggagactatggaacgggctcgggagagc
cttctctgggaagaatccaagggcgggagcgccgtttcgggccggacggcctttgccgcg
gccctgcggggagaccggacagcaaaagcgctgtgcgagacctatgttgaatatctggcg
gcgggcatcgtaaacctgctgaacattttacagccggaggtgcttgccatcggcggaggc
atcagcgaggcggaggacgaactgctgctgacgcctcttaaggagatcgtggaccgggag
agctacgccgcccactgcggcgggaaagccacggtggtcaaggcggagcttggcaacgac
gcgggcatgatcggcgcggcgctgctgaagcgggcaatctga

DBGET integrated database retrieval system