KEGG   Oscillibacter valericigenes: OBV_22120Help
Entry
OBV_22120         CDS       T01636                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ova  Oscillibacter valericigenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ova00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OBV_22120 (ruvA)
Enzymes [BR:ova01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     OBV_22120 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2096145..2096753)
Genome map
AA seq 202 aa AA seqDB search
MFYYVNGTVAEVQPNLAVIDCGGVGYACATTSNTLSGLKKGERAKLYTYLHVAENAFGLY
GFGSVGELNSFKMLIGVSGVGPKAALAILSVSTPETLAMSIITGDEKTLTVAPGIGKKIA
QRIILELKDKMTRESAASGGLALGTGRACGGVVLTNKATEAAAALGVLGYSTAETAAALK
GVDVENLPLEEIIRAGLKKMAR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgttttactatgtgaacggcactgtggcggaggtgcagccgaatctggctgtgattgac
tgcggcggagtggggtatgcctgcgccaccaccagcaataccctctcgggcctaaaaaaa
ggggagagggcaaagctgtatacttatctgcatgtggcggaaaacgcctttgggctatac
ggatttggaagcgttggggagctgaacagctttaaaatgttgattggcgtgtccggcgtg
ggtcccaaggcggcgctggcgattttgtctgtctctacgccggagacgctggccatgtcc
atcatcaccggagatgaaaagacgctgacggtggctcccggtatcggtaagaagatcgcc
cagcgcattattctggagttgaaggacaagatgaccagagagagcgccgcatccggcgga
ctggctctgggcaccggacgcgcctgtgggggagttgtcctgacaaataaagctacggag
gccgccgcggctctgggcgtactgggatactccacggcggagaccgcggccgcgctgaag
ggcgtggatgtggagaacctgccgctggaggagattatccgggcaggcctgaagaaaatg
gcgcggtaa

DBGET integrated database retrieval system