KEGG   Oscillibacter valericigenes: OBV_28260Help
Entry
OBV_28260         CDS       T01636                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ova  Oscillibacter valericigenes
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OBV_28260 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OBV_28260 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OBV_28260 (thrC)
Enzymes [BR:ova01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OBV_28260 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2657185..2658426)
Genome map
AA seq 413 aa AA seqDB search
MKNVKYGKCVKCGRTYEATPDLTTCECGGILDIVYDYDYVKTRLTREKLAARRDVTMWRY
RELLPIEETTENTPLRVGNSPLYEEPRLASRLGLGRLWVKDDGQNPTASLKDRASAMAVA
KAREAGAKVIACSSTGNAASSLAGNAAAAGLKTYIFVPSRAPKGKVAQLMTFGATVISVE
GSYEDTFELSRQAIDKWGWYNRNAAINPYLSEGKKTVSLEIMEQLNWQVPDYLAISVGDG
CTIAGVWKGLKDLYAIGFIDRLPRLISAQAEGCCPLNRAIAEDKPWRPMEENTLADSIAV
GVPRNADKALMAIRESNGIVVNVSDQEIMAAQKLLGRTCGLFGEPAGVTGTAGVKKLCEQ
GVLGKNDTVVSVVTGNGLKDVANAIKSCGEPITIPSDMERLLGAFVERGIVVE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtaaaatacggcaagtgtgtcaagtgcggccgtacctatgaggccacgccg
gatttgaccacctgtgaatgcggtggcattttggacatcgtctacgattatgactatgtc
aagacccggctgaccagagaaaagctggccgcccggcgggatgtgaccatgtggcgctat
cgggagctgctgcccatcgaggagactacggaaaatacccccctgcgggtggggaacagc
ccgctttatgaggagccgcgccttgcatcaaggctgggcctcgggcgtttgtgggtgaag
gacgacggacagaacccaaccgcatccctgaaggaccgggcttccgccatggcggtggca
aaggcccgggaggcgggggcgaaggtcatcgcctgctcttccaccggcaacgccgcctcg
tctctcgcgggcaacgcggcggcggcgggcctgaagacctatatctttgtcccgtcccgc
gcgcccaagggaaaagtggctcagctgatgaccttcggagccacggtcatctccgtggag
ggcagctacgaggatacctttgagctttccaggcaggccatcgataagtggggctggtac
aaccgcaacgccgccattaacccctatttgtccgagggaaagaagacggtctctctggag
attatggagcagctgaactggcaggtgccggattatctggccatctccgtgggcgacggc
tgtaccattgcgggcgtctggaagggcttgaaggatctgtacgccatcggctttatcgac
cggcttccccgtctgatctccgcacaggcggagggctgctgtccgctgaaccgcgccatt
gcggaggataagccgtggcgccctatggaggaaaacacccttgcagactccatcgctgtg
ggcgtgccccggaacgcggacaaggcccttatggccatccgggagtccaacggcatcgtg
gtcaacgtctctgatcaggagatcatggcggcccagaagctattgggccgcacctgcggc
ttgttcggtgagcccgcgggcgtcaccggtacggctggcgtgaaaaagctgtgcgaacag
ggagttctgggaaagaacgacacggtggtgagcgtggtcactggcaacggcctcaaggat
gtggccaacgccattaagtcctgcggcgagccgatcactatcccctccgacatggaacgg
ctgctgggggcgtttgtcgaaaggggcattgtggtggagtga

DBGET integrated database retrieval system