KEGG   Oscillibacter valericigenes: OBV_29900Help
Entry
OBV_29900         CDS       T01636                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ova  Oscillibacter valericigenes
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OBV_29900 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    OBV_29900 (proB)
Enzymes [BR:ova01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     OBV_29900 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2831973..2832812
Genome map
AA seq 279 aa AA seqDB search
MYNCIKDIFLKGADRMNKQRIVVKVGTSTLTHDSGALNLHRMEQLVRVLADLSGMGHQVI
LVSSGAIAIGTARLRLIERPKELRMKQAAAAVGQCRMMHIYDKLFSEYNRTVSQILLTGD
DVDDPVRAEHLSSTFEALLGMGVIPVVNENDSVSSAEIETGQHKVLGDNDTLSAIVARLC
RAGLLILISDIDGLYDADPHSHPEARLIHRVEALTPEILDMAGGAGSWRGTGGMATKLSA
ARITMDAGCDMVITNGQRTEDLYGIVDGQDIGTRFLATK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtataattgcataaaagatattttcctgaagggagctgatagaatgaataagcagcgc
atagtggtgaaggtcggcacctcgactctcactcacgattccggcgcgctgaatctgcac
cgcatggaacagcttgtgcgggtgctggcggatctgagcggaatgggacatcaagtgatt
ttggtatcatccggcgccatcgccatcggcaccgcccggctgcgcctgatagaacggccc
aaagagcttcggatgaagcaggcggcggcggcggtggggcagtgccgcatgatgcacatt
tacgacaaactgttctccgagtataaccgcaccgtctctcagattctgctgacgggagat
gatgtggacgaccccgttcgggcggagcacctctccagtacgtttgaagcgttgttgggc
atgggcgtcatccccgtggtgaatgaaaacgactccgtatcctcggcggaaatcgagact
gggcagcataaggttctgggcgacaacgacacgctgtccgccatcgtggcccgtctgtgc
cgggccggtcttctgatcctgatttcggatattgacggactgtacgacgcggacccccat
tctcacccggaggcgcggctcattcaccgtgtggaagctctgaccccggaaattctggat
atggccggcggcgccggctcctggcgcggtaccggcggcatggccaccaagctctccgcg
gcgcggattacgatggacgccgggtgcgatatggtcatcaccaacggccagcggacagag
gacctgtacggcattgtagacggtcaggatatcggaacccgattcctggcgacgaaataa

DBGET integrated database retrieval system