KEGG   Oscillibacter valericigenes: OBV_35840Help
Entry
OBV_35840         CDS       T01636                                 

Definition
(GenBank) putative nuclease
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ova  Oscillibacter valericigenes
Pathway
ova03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ova00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OBV_35840
Enzymes [BR:ova01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     OBV_35840
DNA repair and recombination proteins [BR:ova03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     OBV_35840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 PIF1 Helicase_RecD UvrD_C AAA_5 AAA_22 DNA_pol_lambd_f HHH_2 AAA_16 ArgK AAA_12 T2SSE HHH AAA_33 NTPase_1 AAA AAA_28 SRP54 DUF853 TsaE CbiA AAA_29 Mg_chelatase UvrD-helicase NACHT
Motif
Other DBs
NCBI-ProteinID: BAL00783
UniProt: G4KWG2
Position
3378670..3380874
Genome map
AA seq 734 aa AA seqDB search
MDELCCLDGTVHSLIFQNAENGYTVLRLVTEEGELHTVVGCIPCVAPGEHLTVNGVWETH
PQHGEQLKAVELERRLPEDADEIFNYLSSGVCKGVGPATARAIVDRFGVRTLDVLEQEPE
KLTCLRGITEKKAQQIGGSFRQQMGLRRLMAFLAQYELPPALAILLRKLYGDAALDAVRA
NPYLLSADECGVSFSATDEIAMSLGIAADSDERLQAAVIFELNHNENNGHVFLPRDKLVA
ATVQLLNCDGDLAEKALDDLCARGAVVQEQVANVTACYLRRLWAAEVSAVARLWVLLSAD
ADQGRQVDRVIAEIEKAQGITYADQQRQAVALAARTGVLILTGGPGTGKTTTVRGIVALF
QRMGLDVMLAAPTGRAAMRMSELCGGLEAQTIHRLLGVTWNETTRETSFTKCEKEPLEAD
AVIVDEMSMVDVSLFAALLRALRPGTRLVLVGDADQLPSVGAGNVFSDLIRSKKVETVFL
REVFRQAEQSAIIRNAHAVNLGQPPRFVNDQNDFFFMCRRSADRAVSTVVDLCKTRLPEK
MGIPADQIQVLSPTRKGESGTESLNRLLQSALNPPAPDKRQRQWGEKVFREGDRIMQTRN
DYDVVWQRSDGIVGTGIFNGDVGRVVQIDPSGEWLQVNFDDRVSTYTADQLSEIDLAYAM
TVHKAQGSEYRAVILAAMSAAPALMVRGVLYTALTRARELLIVVGDDSAVTAMAENDRRQ
RRYSGLKWRLCNGS
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggatgaactctgctgcctggatggcacggtacatagtcttatctttcaaaacgccgaa
aacggctataccgtcctgcggctggtaacggaggagggagaactgcatacggtggtggga
tgcattccctgcgtggcccccggcgaacacctgacggtgaacggcgtgtgggagacccac
ccccagcacggggagcagttgaaagccgtggagctggaacggcggcttccggaggacgcg
gacgagatcttcaactatctctcttccggcgtatgcaagggcgtgggtcccgccacagcc
cgggccatcgtggatcgcttcggggtgcggacgctggatgtactggaacaggagccggag
aagctcacctgtctgcggggcatcaccgagaaaaaggcccaacagatcggcgggagtttc
cgccagcagatggggcttcggcggctgatggcttttctggcccaatacgaactgcccccg
gctctggcgattctgctgcgaaagctatacggggacgcggcgctggatgcggtgcgcgcc
aacccgtatcttctctccgccgatgaatgcggcgtttccttttcggccacggacgagatt
gccatgagtctgggcatcgccgccgacagcgacgaacggcttcaggcggctgtgatcttc
gagttgaaccacaacgagaacaacggccatgtgtttctcccccgcgacaagctggtcgcc
gccaccgtacagcttttaaactgcgacggagacctggcagaaaaggcgctggacgatctc
tgcgcccggggcgcggtggttcaggagcaggtggccaatgtgaccgcctgctatctccgc
cgcctgtgggcggcggaagtctctgctgtagcccggttgtgggtgcttttatccgcggac
gcggatcaggggcggcaggtggaccgggtcatcgcggaaattgaaaaggcccagggcatt
acctatgccgaccagcagcgtcaggccgtggctctggcggcccggaccggagttttaatc
cttaccggcggccccggcaccggcaagaccaccacggtccggggaatcgtggccctgttc
cagcggatgggactggacgtgatgctggcggcccccaccggccgggcggccatgcggatg
agcgagctgtgcgggggactagaggcccagaccatccaccggctgctgggcgtcacctgg
aacgaaaccacccgggaaacctctttcaccaagtgcgaaaaggagccgttagaggccgac
gcggttattgtggacgagatgagcatggtggacgtgtcattgttcgcggcgcttcttcgc
gccctgcggccaggcacccggctggtgctggtgggagacgcggatcagcttccgtcggtg
ggagcgggaaatgtattttccgacctgattcgcagcaaaaaggtggagaccgtctttttg
agggaagtcttccgtcaggcggagcagtccgccatcatccgcaacgcccacgcggtaaac
ttaggccagccgccccggttcgtcaacgaccagaacgacttctttttcatgtgccgccgc
agtgcggaccgggcggtgagcaccgtggtggatctgtgcaagacccgcctgccggagaag
atgggcattccggcggaccagattcaggtcctctcccccacccgaaagggcgagagcgga
acagaaagcctgaatcgtctgcttcaatcggccctgaatccccccgccccggacaagcgc
cagcgccagtggggcgaaaaggtgttccgggagggagaccgcatcatgcagacccgaaac
gactacgacgtggtgtggcagcggtcggacggtatcgttggcactggcattttcaacggc
gacgtgggccgcgtggtgcagatcgaccccagcggcgagtggcttcaggtgaattttgac
gaccgggtttccacgtataccgccgaccagctctccgagatcgacctggcctacgcaatg
acggtccataaagcccagggcagcgagtaccgggcggtgattctggcggcgatgtccgcc
gctccggcgctgatggttcggggtgtgttgtataccgcgctgacccgggccagagagctt
ttaatcgtggtgggagacgactccgccgttaccgccatggcggaaaatgaccgccgccag
cggcggtattcggggcttaaatggcggctgtgcaacgggtcatag

DBGET integrated database retrieval system