KEGG   Oscillibacter valericigenes: OBV_36040Help
Entry
OBV_36040         CDS       T01636                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ova  Oscillibacter valericigenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OBV_36040 (glgB)
Enzymes [BR:ova01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     OBV_36040 (glgB)
Exosome [BR:ova04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OBV_36040 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3401523..3403577)
Genome map
AA seq 684 aa AA seqDB search
MSRWVRSEVMAKMVQASRFHTGTLTEGWTWFGAHPALRRGRAGWSFRVWAPNAAAVSVVG
DFNQWDASAVPMKREGETWVKFLPDLPRYTSYKYAVTGKDGVVRFKADPYGFHTETRPAT
ASKLYDITGFPWTDGKFREKKGNRPVYTSPLNIYEVHLGSWRRPESGEFYDYHTIARDLA
AYVKDMGFNAVELLPVTEHPLDDSWGYQCTGYFAPTSRYGTPFDFMWFVNHMHKNGISVI
LDWVPAHFCKDEQGLYEFDGTCCYEYSDPKKREHAGWGTRVFDYGRPEVVSFLLSSARFW
LEVYHIDGLRVDAVASMLYLDYDRTDGQWTPNKNGGKENLEAVEFLQNLNRMAFSVDPSA
LMVAEESTAWPLVTRPPEAGGLGFNLKWNMGWMNDMCHYLKLDPYFRQFNHRDITFSMVY
AFSENYVLPLSHDEVVHMKGSLVGKMPGDYENQLRSLRGFYAYLLAHPGKKLLFMGPEIG
QWHEWDANGQLDWYLLDAEINRMTQTFFRAANRFYLKTPELWEVDFQRQGFEWLVPDDNR
NNVAVFLRRDAGDRDLLCAVNFSPNSYPDYRVGVPDHRRYVEVFNTDAGEFGGGGYGNSQ
PVEVEVIPSHGRDCSIALRIPPFGGVFLRGEGKSPVKKAAKPAAKIAAEKPERTAESSKA
NPTAEREKTSGKKAAKRPAAKPGK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggtgggtgaggagtgaggtcatggcaaagatggtacaggcttccagattccat
acgggtactctgacagaggggtggacttggtttggcgcgcatcctgcactcaggcggggc
cgggcgggctggtcgttccgggtctgggcacccaacgccgcggcggtaagcgtggtggga
gatttcaaccaatgggatgcctccgcggtgccgatgaagcgggagggggagacttgggtc
aaatttttgccggacctgccccgatatacctcttataagtatgccgtgaccggaaaggac
ggtgtcgtgcgcttcaaggccgacccctatggatttcacacagagacccggcccgctaca
gccagcaaactctatgacatcacgggttttccctggaccgacggaaaattccgggagaaa
aaggggaaccgtcccgtctatacctcgcccttgaacatctacgaggtacacctcggttcc
tggcgcagaccggaaagcggagaattttacgattaccacaccattgccagggatctcgcg
gcctatgtaaaggacatggggttcaacgctgtcgagctgcttccagtgacggagcatccg
ctggacgactcctggggctatcagtgcaccgggtacttcgctcccacgtcccggtacggt
acaccattcgattttatgtggtttgtaaaccacatgcacaaaaacggaatttccgtgatt
ttggactgggttcccgcccatttttgcaaggacgagcagggcctgtacgagtttgacggc
acttgctgctatgagtattccgaccctaaaaagcgggagcacgccggctgggggacccgc
gtctttgactacggaaggccggaggtggtcagttttctgctctcatccgcccggttctgg
ctggaggtctaccacatcgacgggctgcgggtggatgcggtggcctccatgctctatctg
gactatgaccggacggacggccagtggacacccaacaaaaacggagggaaggaaaatctg
gaggccgtcgaatttctgcaaaacctaaaccgtatggccttttccgtggaccccagtgcg
ctgatggtggcggaggagtccacagcctggccgttggtgacccgtccgccggaggcgggc
gggctgggtttcaatctgaagtggaacatgggatggatgaacgatatgtgccactatctg
aagctggacccctatttccgacagttcaaccacagggatattaccttttccatggtgtac
gcattttccgagaactatgtgctgcctctgtcccatgatgaggtggtacatatgaagggg
tcgctggtgggcaaaatgcccggagactatgaaaaccagctccgctccctccggggattt
tacgcctaccttctggcgcatcccggaaagaagctcctttttatgggcccggagatcggc
cagtggcacgagtgggacgcaaacggccagctggactggtatctgctggatgcggagatc
aaccgcatgacccagacatttttccgggctgccaatcggttctatctaaagacgccggag
ctgtgggaggtggacttccagcggcagggctttgaatggctggttccggacgacaaccgc
aacaacgtggcggtctttctccgcagggatgccggggaccgcgatcttttgtgtgcggtg
aatttctcgcccaactcctacccagactaccgggtgggggtacccgatcaccggcggtat
gtggaggtgttcaataccgacgccggggaattcggcggcggcggatacgggaattcgcag
ccggtggaggtggaggtcattccctcccatggacgggattgctcgatagccctgcgcatc
ccgccgtttggaggtgtgtttctccggggcgaggggaagtccccagtgaaaaaggcggcg
aagcccgcggcaaaaatcgcggcggagaagccggagagaaccgcagagtcttccaaagcg
aatccaacggcggaacgagagaaaacatcagggaagaaagccgcgaaaagaccggcggcg
aagcccgggaaataa

DBGET integrated database retrieval system