KEGG   Oscillibacter valericigenes: OBV_40780Help
Entry
OBV_40780         CDS       T01636                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ova  Oscillibacter valericigenes
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    OBV_40780
  Metabolism of other amino acids
   00480 Glutathione metabolism
    OBV_40780
Enzymes [BR:ova01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     OBV_40780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3846657..3847205)
Genome map
AA seq 182 aa AA seqDB search
MTAYDFQVKDNSGKEVSLSEYSGKLLLIVNTASKCGFTPQYDDLEKLYQKYKKRGLVVLG
FPSNQFLAQEPGSNEEISSFCRLNYGVTFPLFSKIDVRGDQMDPLFEYLSNSAPFQGFEM
SKESGRKIRAVVEKYYPENLEGNGIKWNFTKFLVGRDGHVVNRFEPTQTPEELEPVIEAA
LS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatatgattttcaggtaaaagacaacagtggcaaggaggtttccctttcggag
tattccggaaagcttctcctgattgtgaacaccgcaagcaaatgcggatttacgccgcaa
tatgatgacctggaaaaactttatcagaaatataagaagcggggcctggttgtccttggg
tttccatccaaccaatttctcgctcaggaaccaggcagcaatgaagaaatctcttctttc
tgccggttgaattacggtgtcacattcccgctcttttccaagatcgatgtgcggggcgac
cagatggacccgttgtttgaatacctgagtaacagcgcgcctttccagggctttgaaatg
tcgaaagagtccggcagaaaaataagggctgtggttgaaaaatactatccggaaaatctg
gagggaaacgggatcaaatggaatttcaccaagtttcttgtgggaagggacgggcatgtg
gtaaaccgctttgagccaacccaaacccctgaggagctggaaccggttatcgaagcagct
ctttcataa

DBGET integrated database retrieval system