KEGG   Oscillibacter valericigenes: OBV_46470Help
Entry
OBV_46470         CDS       T01636                                 

Definition
putative glycoside hydrolase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ova  Oscillibacter valericigenes
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ova00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ova00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4399439..4400650
Genome map
AA seq 403 aa AA seqDB search
MKRLLYSLLAAASLFCLTSCAAPPSASPGSSAAESFPAESAGSASKSSGSGASSSAPVQT
NEERAKALTAQMTLEEKVGQLFFARVPDTDAAADVSAYHLGGYILFGRDTKDKTANELIQ
AINRYQEAARIPLLIGVDEEGGTVVRVSSNPNIRAEKFRSPQQLYAAGGMDAVVKDTHEK
DILLKALGFNVNLAPVADVSTDPNDFIYDRSFGQDAQATAEYVRSVVKQMRADGMGCVLK
HFPGYGNNVDTHTGIAVDKRPIEQFENSDFLPFKAGLEAGGDTVSVLVSHNIVDCLTSKA
DAGFPASLSPNVHISLRLMMQEVGGGGPIMTDDLAMDAVKSYAENDSVAVMAIKATNSLL
IATDYRQQIPQVISAVEDGTLDENLVDFACAQVLQWKIALGLL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgattgctctattccctgctggccgcggccagcctgttttgtctgacttcctgc
gccgcgcctccttcggcttccccgggctcttccgctgcggaaagtttcccggcggagagc
gccggttccgcctctaagtccagcggtagcggggcatcctcgtccgctcccgttcaaacc
aacgaggagcgggcgaaggccctgacggcccagatgactcttgaggaaaaagtggggcag
ctgttttttgcccgggtccccgatacggacgcggcggcggatgtatccgcctatcacctg
ggaggctatattctctttggccgggacacgaaggacaaaaccgccaacgagcttatccag
gcgatcaaccgctatcaagaggccgcccgtattcccctgctcatcggcgtggacgaggag
ggtggtactgtggtgcgcgtctcctccaatccaaacattcgcgcggaaaaatttcgctca
ccccagcaactctacgccgccggcggtatggacgccgtggtgaaagatacccatgaaaag
gatatattgctcaaagcgctggggttcaacgtaaatttggccccggtagcggatgtgtcc
accgaccccaatgacttcatctatgaccgctccttcggtcaggacgcacaggctacggcg
gagtacgtccgctccgtggtaaagcaaatgcgcgccgacgggatgggctgtgtcctcaag
cactttcccggctatgggaacaatgtggatacccataccggtatcgccgtcgataagcgg
cccattgaacagtttgaaaactccgattttctcccttttaaagccggtcttgaggcgggc
ggcgatacggtttccgttttggtgagccataacattgtggactgtctgacctccaaggct
gacgcgggttttccggcctctctctctccaaatgtgcacatttctcttcgtctgatgatg
caggaagtaggtggaggcggtccaattatgaccgacgatctggctatggacgcggtaaag
tcctatgcggaaaacgacagcgtggcggtcatggcaatcaaagccacaaacagccttctg
atcgccacagactaccgccagcagattccgcaggtcatttccgccgtggaggacgggacg
ctggacgaaaaccttgtcgatttcgcctgcgcccaggtgctccagtggaaaatagctctg
gggctgttgtga

DBGET integrated database retrieval system