KEGG   Oscillibacter valericigenes: OBV_46470Help
Entry
OBV_46470         CDS       T01636                                 

Definition
putative glycoside hydrolase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ova  Oscillibacter valericigenes
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OBV_46470
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    OBV_46470
Enzymes [BR:ova01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     OBV_46470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4399439..4400650
Genome map
AA seq 403 aa AA seqDB search
MKRLLYSLLAAASLFCLTSCAAPPSASPGSSAAESFPAESAGSASKSSGSGASSSAPVQT
NEERAKALTAQMTLEEKVGQLFFARVPDTDAAADVSAYHLGGYILFGRDTKDKTANELIQ
AINRYQEAARIPLLIGVDEEGGTVVRVSSNPNIRAEKFRSPQQLYAAGGMDAVVKDTHEK
DILLKALGFNVNLAPVADVSTDPNDFIYDRSFGQDAQATAEYVRSVVKQMRADGMGCVLK
HFPGYGNNVDTHTGIAVDKRPIEQFENSDFLPFKAGLEAGGDTVSVLVSHNIVDCLTSKA
DAGFPASLSPNVHISLRLMMQEVGGGGPIMTDDLAMDAVKSYAENDSVAVMAIKATNSLL
IATDYRQQIPQVISAVEDGTLDENLVDFACAQVLQWKIALGLL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgattgctctattccctgctggccgcggccagcctgttttgtctgacttcctgc
gccgcgcctccttcggcttccccgggctcttccgctgcggaaagtttcccggcggagagc
gccggttccgcctctaagtccagcggtagcggggcatcctcgtccgctcccgttcaaacc
aacgaggagcgggcgaaggccctgacggcccagatgactcttgaggaaaaagtggggcag
ctgttttttgcccgggtccccgatacggacgcggcggcggatgtatccgcctatcacctg
ggaggctatattctctttggccgggacacgaaggacaaaaccgccaacgagcttatccag
gcgatcaaccgctatcaagaggccgcccgtattcccctgctcatcggcgtggacgaggag
ggtggtactgtggtgcgcgtctcctccaatccaaacattcgcgcggaaaaatttcgctca
ccccagcaactctacgccgccggcggtatggacgccgtggtgaaagatacccatgaaaag
gatatattgctcaaagcgctggggttcaacgtaaatttggccccggtagcggatgtgtcc
accgaccccaatgacttcatctatgaccgctccttcggtcaggacgcacaggctacggcg
gagtacgtccgctccgtggtaaagcaaatgcgcgccgacgggatgggctgtgtcctcaag
cactttcccggctatgggaacaatgtggatacccataccggtatcgccgtcgataagcgg
cccattgaacagtttgaaaactccgattttctcccttttaaagccggtcttgaggcgggc
ggcgatacggtttccgttttggtgagccataacattgtggactgtctgacctccaaggct
gacgcgggttttccggcctctctctctccaaatgtgcacatttctcttcgtctgatgatg
caggaagtaggtggaggcggtccaattatgaccgacgatctggctatggacgcggtaaag
tcctatgcggaaaacgacagcgtggcggtcatggcaatcaaagccacaaacagccttctg
atcgccacagactaccgccagcagattccgcaggtcatttccgccgtggaggacgggacg
ctggacgaaaaccttgtcgatttcgcctgcgcccaggtgctccagtggaaaatagctctg
gggctgttgtga

DBGET integrated database retrieval system