KEGG   Prosthecochloris aestuarii: Paes_0043Help
Entry
Paes_0043         CDS       T00732                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
paa  Prosthecochloris aestuarii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:paa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
43731..45119
Genome map
AA seq 462 aa AA seqDB search
MNHTSDQHGNEPLDRAKGYVYIVGAGPGDPELITVKAQRVLSEADVILYDDLVSLELVDQ
FNALKIYTGKRKDSHHFEQEEINREIVRHASEGKTVVRLKGGDPFIFGRGGEEIDTLRNV
GIHYEIIPGITAAHGASAYTEIPLTMRRISSSVAFCTGHPVNRIQVPDTDTIVYYMVAST
VHDVLDAVAAKGRSGATMVAVVQSATQYNQKTYTGTLDEFRRREKAVYSPALLIIGDSIG
QFIEHNWHSRKKKVLMTGGDSSRYSSTDYIMVHFPCRKISGADLDAVNRVLDHIADYSLL
FFPNKFSVKYFFRFLFESGRDVRSLAHMTICTAGSAAAAELQESGLVADHYLEPDGTVGY
AERLRELCVSGQQILLPGSSITDDSLVAGLTQMGNSVTPLGVYAHEVRQDEVIDLDFIDE
IYFSSPVCVRNFQTLFKTIPGRITVTTADRSTQNEYDSLFGD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatacatcagatcagcatggcaacgaacctcttgatagagcaaaaggttatgtt
tacatcgtcggtgcgggtcccggcgatccggaactgattaccgtcaaggctcaaagagtg
ctctctgaagccgatgtcatcctctacgacgatcttgtcagccttgaactggtcgatcag
ttcaacgcgttgaagatctataccggcaaacgcaaggacagtcaccatttcgagcaggag
gagatcaatcgtgagattgtccgtcatgccagtgaaggcaaaacagtcgttcgtcttaaa
gggggagacccgtttatttttggccggggtggagaggaaatcgatacattgcgcaacgtc
gggattcattacgagatcattccgggcattacggctgcccacggtgcgagcgcctatacc
gagataccgctcaccatgcgcaggatatcctcttccgtcgctttctgtacaggccatccg
gtcaacaggattcaggtgcccgataccgatacgatcgtctactacatggttgcctccacg
gtccatgacgtgcttgatgcggttgcagccaaagggcgctccggggcgactatggtcgct
gttgtgcagagcgctacgcagtacaatcagaaaacctacaccggaacgctcgacgagttc
aggaggcgtgaaaaggctgtctactcgcctgctctgcttattataggcgacagcatcggt
cagtttatagagcacaactggcattcgcgcaagaaaaaggtgctgatgaccggcggggat
tcaagccgttacagcagcacagattatattatggtccactttccctgtcgcaagatttca
ggggcggatctcgatgcggtcaatcgagtgctcgatcatatcgcagactattcgctcctt
tttttccctaacaagttttcggtcaagtacttttttcgcttccttttcgagtcaggcagg
gatgtgcgaagtctggcccatatgaccatctgtaccgccggcagtgctgccgcagctgaa
cttcaggagtcgggccttgttgcggatcattaccttgaaccggacgggacggtcggttac
gcggagcgtcttcgtgagttgtgcgttagcggtcagcagatcctgcttccgggatccagc
attacggacgattcgctcgtcgccggtctcacgcaaatgggcaacagcgttacaccgctt
ggcgtatacgcccatgaggtgcgccaggatgaggtgatcgatctcgacttcatcgatgaa
atctatttctcgtcacctgtctgtgtcagaaacttccagacgctgttcaagacgattccc
ggtcgcatcaccgtcacgactgctgaccgcagtacacagaacgagtacgactcgctcttc
ggtgactga

DBGET integrated database retrieval system