KEGG   Prosthecochloris aestuarii: Paes_0052Help
Entry
Paes_0052         CDS       T00732                                 

Definition
phosphoenolpyruvate carboxykinase (EC:4.1.1.32)
Orthology
K01596  
phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_0052
   00020 Citrate cycle (TCA cycle)
    Paes_0052
   00620 Pyruvate metabolism
    Paes_0052
Enzymes [BR:paa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     Paes_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
55552..57420
Genome map
AA seq 622 aa AA seqDB search
MTSLHINPPDYVKNQKLIAWVQQTAELCQPDSVHWCDGSQEEYDALCQQMVESGTFIRLS
DEKRPNSFLCRSDPSDVARVEDRTFICSIRKQDAGPTNNWVAPKEMKATLKEQYSGCMKG
RTMYVIPFSMGPIGSYISHVGVEITDSPYVVTNMRIMTRMGRKVENLLGEDREFVHCLHS
VGAPLEEGQQDVAWPCNDVKYIVHFPEERSIMSYGSGYGGNALLGKKCFALRIASSMARD
EGWLAEHMLILCVESPEGEKTYVAAAFPSACGKTNFAMLIPPDSFEGWKVTTIGDDIAWI
KPGKDGRLYAINPENGFFGVAPGTSEKTNFNAMATLKENCIFTNVAMTPDGDVWWEGMTK
TPPEGLTDWQGNAWTPDSGRPAAHPNARFTSPASQCPSIDPEWENPDGVPISAFIFGGRR
SDVVPLVYQSPNWYFGVYLAATMGSEKTAAAAGKIGEVRRDPFAMLPFCGYHMGDYFTHW
LHVGRLLSDPPRIFGVNWFGKDEDGNFLWPGFGDNMRVLKWIVDRVHGRASAVESPLGWM
PKYESMDLEGLEDFTPEQFTKLMTVDRESWKKELLSHEELFEKLYDRLPKEFAHIRELLL
STFWLSPEHWALAAERFTGEHN
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgacttctttgcacatcaatccccccgattatgtgaaaaaccagaaattaattgcatgg
gtccagcaaacagcagagctctgtcagccggactccgtgcactggtgtgacggctctcag
gaagagtatgacgcgctctgccagcagatggttgaaagcgggacctttatcaggctgtcg
gatgaaaaacgtccgaacagttttctctgccggtccgatcccagcgacgtcgccagagtc
gaggacagaacctttatctgcagtatccgcaaacaggatgcaggcccgactaacaactgg
gttgcacctaaggagatgaaggcgacgcttaaagagcagtacagcggttgcatgaaaggg
cgaaccatgtacgtcattcccttcagtatggggccgatcgggtcctatatctcgcatgtc
ggtgttgagattaccgattcgccgtatgttgttaccaatatgcgcatcatgaccagaatg
gggcgcaaggtagagaacctcctcggcgaggatagagagtttgttcattgcctgcactct
gtgggcgctcccctggaggaaggccagcaggatgttgcgtggccgtgcaacgatgttaaa
tatatcgttcatttccctgaagagcgttcgatcatgtcgtacggcagtggttacggaggc
aacgcgctgctcggcaaaaaatgctttgcgcttcgtatcgcatcgtcgatggcccgtgat
gagggctggcttgccgaacatatgctgattctctgcgtggaatcaccggaaggtgagaaa
acctatgtcgctgctgcattcccgagtgcctgcggtaagaccaactttgccatgctcatt
cctccggattcgttcgaggggtggaaggtgaccacgatcggagacgatattgcctggatc
aagcctggcaaagatggacgtctctacgctattaatccggaaaacggtttcttcggtgtt
gctcccggtacctccgaaaagaccaatttcaatgccatggcaacgctgaaagaaaattgc
attttcaccaatgtggcgatgactcctgacggtgatgtctggtgggaaggcatgacaaag
actccgcctgaaggtttgaccgactggcagggcaatgcgtggacccctgattcgggacgt
cccgccgcccatcccaacgcacgtttcacgtcgccggcatcacagtgtccctctattgat
cctgaatgggaaaaccctgacggtgtcccgatcagcgcctttatttttggcggtcgacgc
agtgatgtcgtgcctctcgtttatcagtcaccaaactggtacttcggcgtctaccttgcc
gccactatgggctcggaaaagactgccgcagcagcaggaaagattggtgaggttcgccgc
gatccttttgccatgctgccgttctgcggttatcatatgggagactatttcactcactgg
ctgcacgtcggacgtctgctttctgatcctccgagaattttcggtgttaactggttcggt
aaggacgaggatggcaatttcctctggcccggattcggtgacaacatgcgggtcctgaaa
tggatcgttgatcgcgtgcatggccgtgccagcgctgttgaaagcccgcttggctggatg
ccgaagtacgagtctatggaccttgagggccttgaagactttactcccgagcagtttacc
aagcttatgacggtcgatcgggagagctggaaaaaagagctgctttctcatgaagagctt
tttgagaagctttatgacagacttccgaaagagtttgcccatatccgtgaactgctgctt
tccaccttctggctctcacctgaacactgggcccttgcggcagagcgtttcaccggtgag
cataactga

DBGET integrated database retrieval system