KEGG   Prosthecochloris aestuarii: Paes_0260Help
Entry
Paes_0260         CDS       T00732                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00260  Glycine, serine and threonine metabolism
paa00750  Vitamin B6 metabolism
paa01100  Metabolic pathways
paa01110  Biosynthesis of secondary metabolites
paa01120  Microbial metabolism in diverse environments
paa01230  Biosynthesis of amino acids
Module
paa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Paes_0260
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Paes_0260
Enzymes [BR:paa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Paes_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACF45317
JGI: Paes0260
UniProt: B4S3X1
Position
complement(269510..270826)
Genome map
AA seq 438 aa AA seqDB search
MIYYSTNKSSTPASLKRATLEGLAPDGGLYVPSAIPVFSPSEIELLKEAPFKDIAFAIAK
KYTGSEIPPDRLYEIIEECFNFPTPLVPLDNNTFIEELFHGPTLAFKDYGARFLARMTGY
FAEEDHTLITILVATSGDTGSAVAYGFQGIPNTRVVLLYPSGKVSRLQEQQLTTAGGNVT
ALEVKGDFDDCQRLVKQAFMDGSIKQNLTLTSANSINISRLIPQSFYYAWAALQLDRKYP
GKKAVFSVPSGNYGNLTAGVLAKMMGFPIDHFIAASNANDSVTRYIEEGRYEPHPTIRTL
STAMDVGDPSNFARLRHIYANDHTKMAADITGYSISDNETLETIRSVYDRFGYIMDPHTA
VGSRALELWREQMTQADSNPAVVLSTAHPAKFLESIREALDMEISIPDRLQTVLDKQKIA
TLIGSDYNELSAFLSALD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatttactacagtaccaataaatcttcgacaccggcaagcctcaaaagagcgacgctt
gagggtctagcccccgatggcggcctctatgtcccgtctgccataccggttttctctccc
tcggagatcgaactgctcaaagaagctccgtttaaggatattgcctttgccatagcaaaa
aaatataccggaagtgaaattccccctgaccgtctctacgagatcattgaagagtgcttc
aatttcccaaccccactggtacctctcgacaacaacacgtttatcgaggaactcttccat
ggccccacacttgcgttcaaagactacggtgcacgttttctggccagaatgaccggttat
ttcgcagaggaagatcatacactcattaccatcctcgtagcgacttccggagacacgggt
agcgctgtagcctacggatttcagggtattcccaatacacgggtcgtcctgctctatcca
tccggaaaagtcagccgccttcaggaacagcagctgacaaccgcaggaggaaacgtcaca
gcacttgaggtcaaaggtgattttgatgattgtcaaaggcttgtcaaacaagcatttatg
gacggatcgatcaagcagaatctcaccctgacatcggcaaactccatcaatatatcgcgt
ctcatcccccagtcgttctactatgcatgggcagcgctgcaactcgacagaaagtatccg
gggaaaaaagctgtcttctcggttccgagcggaaactacggcaaccttaccgctggcgta
ctggcaaaaatgatgggattcccgatcgatcactttattgcagcctccaatgcaaacgac
agcgttacacgctatattgaagagggacgctatgagcctcatccgacaatccgtacactg
tcgacggcaatggatgtcggcgatccaagcaatttcgcccgcctgcgccacatctatgcc
aatgatcacacgaaaatggctgcagatattacaggctactcgatctcggacaacgaaacg
ctcgaaaccatcagaagcgtctacgaccgtttcggctatatcatggatccgcataccgct
gtcggcagcagggctcttgaactctggagagagcagatgacgcaagccgattccaacccg
gctgtcgtactgtcgacagcgcatccggcaaaattccttgaatcgatccgtgaagcgctc
gatatggagatatccatccctgacagattgcagaccgttctggataaacagaaaatagca
accctgatcggttccgactacaatgaactctcagcgtttctttctgcactcgattaa

DBGET integrated database retrieval system