KEGG   Prosthecochloris aestuarii: Paes_0260Help
Entry
Paes_0260         CDS       T00732                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Paes_0260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Paes_0260
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Paes_0260
Enzymes [BR:paa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Paes_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(269510..270826)
Genome map
AA seq 438 aa AA seqDB search
MIYYSTNKSSTPASLKRATLEGLAPDGGLYVPSAIPVFSPSEIELLKEAPFKDIAFAIAK
KYTGSEIPPDRLYEIIEECFNFPTPLVPLDNNTFIEELFHGPTLAFKDYGARFLARMTGY
FAEEDHTLITILVATSGDTGSAVAYGFQGIPNTRVVLLYPSGKVSRLQEQQLTTAGGNVT
ALEVKGDFDDCQRLVKQAFMDGSIKQNLTLTSANSINISRLIPQSFYYAWAALQLDRKYP
GKKAVFSVPSGNYGNLTAGVLAKMMGFPIDHFIAASNANDSVTRYIEEGRYEPHPTIRTL
STAMDVGDPSNFARLRHIYANDHTKMAADITGYSISDNETLETIRSVYDRFGYIMDPHTA
VGSRALELWREQMTQADSNPAVVLSTAHPAKFLESIREALDMEISIPDRLQTVLDKQKIA
TLIGSDYNELSAFLSALD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatttactacagtaccaataaatcttcgacaccggcaagcctcaaaagagcgacgctt
gagggtctagcccccgatggcggcctctatgtcccgtctgccataccggttttctctccc
tcggagatcgaactgctcaaagaagctccgtttaaggatattgcctttgccatagcaaaa
aaatataccggaagtgaaattccccctgaccgtctctacgagatcattgaagagtgcttc
aatttcccaaccccactggtacctctcgacaacaacacgtttatcgaggaactcttccat
ggccccacacttgcgttcaaagactacggtgcacgttttctggccagaatgaccggttat
ttcgcagaggaagatcatacactcattaccatcctcgtagcgacttccggagacacgggt
agcgctgtagcctacggatttcagggtattcccaatacacgggtcgtcctgctctatcca
tccggaaaagtcagccgccttcaggaacagcagctgacaaccgcaggaggaaacgtcaca
gcacttgaggtcaaaggtgattttgatgattgtcaaaggcttgtcaaacaagcatttatg
gacggatcgatcaagcagaatctcaccctgacatcggcaaactccatcaatatatcgcgt
ctcatcccccagtcgttctactatgcatgggcagcgctgcaactcgacagaaagtatccg
gggaaaaaagctgtcttctcggttccgagcggaaactacggcaaccttaccgctggcgta
ctggcaaaaatgatgggattcccgatcgatcactttattgcagcctccaatgcaaacgac
agcgttacacgctatattgaagagggacgctatgagcctcatccgacaatccgtacactg
tcgacggcaatggatgtcggcgatccaagcaatttcgcccgcctgcgccacatctatgcc
aatgatcacacgaaaatggctgcagatattacaggctactcgatctcggacaacgaaacg
ctcgaaaccatcagaagcgtctacgaccgtttcggctatatcatggatccgcataccgct
gtcggcagcagggctcttgaactctggagagagcagatgacgcaagccgattccaacccg
gctgtcgtactgtcgacagcgcatccggcaaaattccttgaatcgatccgtgaagcgctc
gatatggagatatccatccctgacagattgcagaccgttctggataaacagaaaatagca
accctgatcggttccgactacaatgaactctcagcgtttctttctgcactcgattaa

DBGET integrated database retrieval system