KEGG   Prosthecochloris aestuarii: Paes_0276Help
Entry
Paes_0276         CDS       T00732                                 

Definition
dolichyl-phosphate beta-D-mannosyltransferase (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
paa  Prosthecochloris aestuarii
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
289999..290736
Genome map
AA seq 245 aa AA seqDB search
MADVRSDVLVIIPTYNEADNIGKLIDELMSRYPHHLDVLVIDDNSPDATADIVRTQKKRY
GDRLHLIERERKQGLGTAYIAGFRYGLQRGYAFLAEMDADYSHDPAALEQMLQEARHYDL
VIGSRYINNTVNVVNWPLARLVLSKTASMYTRWVTGLPVSDPTSGYKCFRADMLRKIDLH
RVNSQGYSFQIEMNYRVWKLGGSLQEIPIIFIDRTVGQSKMSRKNIVEAVWIVWFLKAKS
ILRLL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtgagatctgacgttttagttatcattccgacctacaacgaagccgataat
attggaaagctcatcgacgagctcatgagtcgctatccgcaccatcttgacgtgctggtt
atcgatgataattcccctgacgcaacagctgatatcgtcagaacacaaaagaagcggtat
ggtgaccgccttcatcttattgaacgagagcgcaaacagggtctggggacagcctatatt
gcagggtttcgctatggtcttcagcgaggttacgcttttctggcggaaatggatgctgat
tactcgcatgatcctgccgcacttgaacaaatgctccaggaagctcgccattacgatctt
gtcattggttcccgctacatcaacaataccgtcaatgttgtcaactggcctctcgccagg
cttgtgctatcaaagacagcaagtatgtatacccgatgggttacaggactgcctgtatcg
gatcctacaagcggctataaatgcttcagagcagatatgctgagaaaaatcgatttgcac
agagtcaattcgcaaggatattcatttcagattgagatgaactaccgggtgtggaaactc
gggggatcattgcaggagattccaattatttttatcgaccgtacggttggtcaatctaaa
atgtcaaggaagaatattgtggaggcagtctggattgtctggtttctcaaggcgaaatcc
atcctgcgactcctgtag

DBGET integrated database retrieval system