KEGG   Prosthecochloris aestuarii: Paes_0335Help
Entry
Paes_0335         CDS       T00732                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
paa  Prosthecochloris aestuarii
Brite
Enzymes [BR:paa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Paes_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
363381..364085
Genome map
AA seq 234 aa AA seqDB search
MASKKDSSRNSPVQEGDHVFQSRRRDMVSQLMRYGISDKRVLDAFLQVPRHLFFDIADRT
YAYDDGAFPIGFGQTISQPYTVAYMTAILSKRCPAGKVLEIGTGSGYQAAILDAMGYRVY
TVERIEGLYERSGRVFDRLGLHVQQMLGDGSGGWLSEAPFDGIIVTAGAPDVPHSLVSQL
KVGGCLVIPVGGSDGQWMTVVTKTAAGFRREVYERFAFVPLIGREGWNEVDDGG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaaaaaagattcttcacgaaattcacctgtgcaggaaggcgatcatgttttt
cagtcaaggcgtcgcgatatggtgagccagctgatgcgatacgggatctccgataagcgg
gtacttgatgcttttcttcaggtgccccggcatctttttttcgatattgccgacagaacg
tatgcttacgatgacggggcatttcctattggattcggtcagaccatctcccagccctat
actgtggcctatatgacggctatattgtccaaacggtgtcctgcaggaaaggtgctcgaa
ataggtaccggttcggggtatcaggcagctattctcgatgcgatgggctatcgggtctac
accgttgaacgcattgaggggctctatgagcgttcaggaagggtattcgatcgtcttggt
ctccatgtacagcagatgctgggcgatggttcaggtggctggctctctgaggccccgttt
gatggtattatcgttacagcaggagctcctgatgtgccgcattctcttgtctctcagctg
aaagtggggggctgccttgtcattcctgtcggcgggagtgacggacagtggatgacagtg
gtgaccaaaaccgctgcagggtttcggcgtgaagtctatgaacgttttgctttcgttcct
ctgataggcagggagggctggaacgaggtggatgacgggggataa

DBGET integrated database retrieval system