KEGG   Prosthecochloris aestuarii: Paes_0504Help
Entry
Paes_0504         CDS       T00732                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_0504
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_0504
   00620 Pyruvate metabolism
    Paes_0504
   00640 Propanoate metabolism
    Paes_0504
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Paes_0504
   00680 Methane metabolism
    Paes_0504
Enzymes [BR:paa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Paes_0504
Lipid biosynthesis proteins [BR:paa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Paes_0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(542160..544154)
Genome map
AA seq 664 aa AA seqDB search
MATDKNTSHPQESPENESISSVLSEKRKFPPPSEFSENAHISSMEQYEQLYSQAEKDPEA
YWAGVAEEFHWEKKWDSVLEWNSPYAKWFPGATTNICYNAVDRHVNSWRKNKAAIIWEGE
EGEQRVLTYGELHRQVSKFANVLKIAGIKPGDRVAIYMGMVPELVVAVLACARVGAVHNV
IFAGFSAHAITERVNDSKAKLIICSDGTRRRGNTINLKDIVDDAIVNTPSVRSVIVLKVT
NEEVTMHDGMDHWWHDLMGLALDHNDPEFVDAEHPLFILYTSGSTGKPKGILHTTGGYMV
HAASSFRYVFDIKDEDIYWCTADVGWITGHSYLVYGPLLNGATLMMYEGAPNYPQWDRFW
DIINRHKITILYTAPTAIRAFIRAGDEWVNKHDLSTLRLLGTVGEPINPKAWMWYHSVVG
KEKCPIVDTWWQTETGGILVSPLPGATPTKPGTATRPLPGILVDVVRKDGTPCNANEGGY
LVIKKPWPSMLRTIYGDNKRYEETYWSEFKDMYFTGDGARKDEDGYIWIMGRVDDVVNVS
GHRLGTSEVESALVAHESVAEAAVVSRPDEIKGNALIAFVTLKDEYQGDMKLREELRAHV
SKEIGPIAKPDEIRWAQGLPKTRSGKIMRRLLRELASSKEIKGDVTTLEDFGVLEQLRGQ
EDED
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggctacggacaaaaacacatcacatccgcaagaatcccccgaaaacgaatcgatcagt
tccgtcctgtctgaaaaacgcaagtttcctcccccgtccgagttctcagaaaacgctcat
atatcctcaatggagcagtatgaacagctctatagccaagcagagaaagatcctgaagct
tactgggcaggcgtagctgaggagttccattgggaaaaaaaatgggattcggtactcgaa
tggaattctccctatgccaagtggttccccggcgcaacaacaaacatctgctacaatgcc
gttgaccgtcatgtcaacagctggagaaaaaacaaggccgccattatctgggaaggtgaa
gagggtgaacagcgggttctcacctacggcgaactccacagacaggtcagcaagttcgcc
aacgtcctgaaaattgcgggcatcaagcctggtgacagagtagccatttatatggggatg
gtgcctgaactggtggtcgccgttcttgcatgcgcccgtgtcggagctgtccacaatgtc
attttcgcagggttctccgcccacgccattaccgaaagggtcaacgactcaaaagcaaaa
ctgatcatctgctccgacggaacccgccgacgcggcaatacgatcaatctgaaagacatc
gttgacgatgcaattgtcaacactccctcggtccgtagcgtcattgtcctgaaagtcacc
aatgaagaggttaccatgcatgacggtatggaccactggtggcatgacctcatggggctg
gccctcgatcataacgatcccgagttcgtcgatgcagagcatccgctcttcattctctat
accagcggatcgactggaaaaccgaaaggaattctccatacaacgggcggttatatggtt
catgcagccagctcgttcaggtatgtcttcgacatcaaggacgaagacatttactggtgt
actgccgatgtgggctggattaccggtcacagctatctggtttacggtccgctgctcaac
ggtgcaaccctgatgatgtatgaaggcgcaccgaactacccgcagtgggaccgcttctgg
gatattatcaaccgccacaaaatcaccattctctatactgctccgacggcgatacgggcg
tttatccgcgcaggtgacgagtgggtcaacaaacacgacctcagcacgctcagacttctc
ggcaccgttggtgaaccgatcaatccgaaagcatggatgtggtaccactccgttgtaggc
aaagaaaagtgtccgatcgtcgacacctggtggcagacagaaaccggaggcatcctggtc
tcgccccttcctggagcgaccccgacaaaaccgggcacggcaacccgtccgcttcccggt
atcctggtcgatgtcgttcgtaaggatggcacgccctgtaacgccaacgaaggcggctac
ctggtcatcaagaaaccatggccatcgatgcttcgcacgatttacggtgacaataaacgc
tatgaagagacctactggtctgaattcaaggatatgtatttcaccggtgatggcgcccgc
aaagacgaagatggctatatctggatcatgggacgcgtcgacgatgttgtcaacgtctcc
ggacaccgtcttggcaccagcgaagtagaaagcgctctcgttgcccacgaatctgtcgcc
gaagcagctgtcgtcagccgtccggatgagatcaagggcaacgctctgatcgcattcgtc
acgctcaaggatgaatatcagggcgacatgaaacttcgcgaggagttgagagcccatgtt
tccaaagagatcggcccgatagccaaacccgacgaaatcagatgggcccagggccttccc
aaaaccagaagcggcaaaatcatgcgccgacttctgcgcgaactggcctcaagcaaagag
atcaagggcgatgttaccacgcttgaagatttcggcgtgctcgaacagttgcgcggacag
gaagacgaagattaa

DBGET integrated database retrieval system