KEGG   Prosthecochloris aestuarii: Paes_0504Help
Entry
Paes_0504         CDS       T00732                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_0504
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_0504
   00620 Pyruvate metabolism
    Paes_0504
   00640 Propanoate metabolism
    Paes_0504
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Paes_0504
   00680 Methane metabolism
    Paes_0504
Enzymes [BR:paa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Paes_0504
Lipid biosynthesis proteins [BR:paa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Paes_0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(542160..544154)
Genome map
AA seq 664 aa AA seqDB search
MATDKNTSHPQESPENESISSVLSEKRKFPPPSEFSENAHISSMEQYEQLYSQAEKDPEA
YWAGVAEEFHWEKKWDSVLEWNSPYAKWFPGATTNICYNAVDRHVNSWRKNKAAIIWEGE
EGEQRVLTYGELHRQVSKFANVLKIAGIKPGDRVAIYMGMVPELVVAVLACARVGAVHNV
IFAGFSAHAITERVNDSKAKLIICSDGTRRRGNTINLKDIVDDAIVNTPSVRSVIVLKVT
NEEVTMHDGMDHWWHDLMGLALDHNDPEFVDAEHPLFILYTSGSTGKPKGILHTTGGYMV
HAASSFRYVFDIKDEDIYWCTADVGWITGHSYLVYGPLLNGATLMMYEGAPNYPQWDRFW
DIINRHKITILYTAPTAIRAFIRAGDEWVNKHDLSTLRLLGTVGEPINPKAWMWYHSVVG
KEKCPIVDTWWQTETGGILVSPLPGATPTKPGTATRPLPGILVDVVRKDGTPCNANEGGY
LVIKKPWPSMLRTIYGDNKRYEETYWSEFKDMYFTGDGARKDEDGYIWIMGRVDDVVNVS
GHRLGTSEVESALVAHESVAEAAVVSRPDEIKGNALIAFVTLKDEYQGDMKLREELRAHV
SKEIGPIAKPDEIRWAQGLPKTRSGKIMRRLLRELASSKEIKGDVTTLEDFGVLEQLRGQ
EDED
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggctacggacaaaaacacatcacatccgcaagaatcccccgaaaacgaatcgatcagt
tccgtcctgtctgaaaaacgcaagtttcctcccccgtccgagttctcagaaaacgctcat
atatcctcaatggagcagtatgaacagctctatagccaagcagagaaagatcctgaagct
tactgggcaggcgtagctgaggagttccattgggaaaaaaaatgggattcggtactcgaa
tggaattctccctatgccaagtggttccccggcgcaacaacaaacatctgctacaatgcc
gttgaccgtcatgtcaacagctggagaaaaaacaaggccgccattatctgggaaggtgaa
gagggtgaacagcgggttctcacctacggcgaactccacagacaggtcagcaagttcgcc
aacgtcctgaaaattgcgggcatcaagcctggtgacagagtagccatttatatggggatg
gtgcctgaactggtggtcgccgttcttgcatgcgcccgtgtcggagctgtccacaatgtc
attttcgcagggttctccgcccacgccattaccgaaagggtcaacgactcaaaagcaaaa
ctgatcatctgctccgacggaacccgccgacgcggcaatacgatcaatctgaaagacatc
gttgacgatgcaattgtcaacactccctcggtccgtagcgtcattgtcctgaaagtcacc
aatgaagaggttaccatgcatgacggtatggaccactggtggcatgacctcatggggctg
gccctcgatcataacgatcccgagttcgtcgatgcagagcatccgctcttcattctctat
accagcggatcgactggaaaaccgaaaggaattctccatacaacgggcggttatatggtt
catgcagccagctcgttcaggtatgtcttcgacatcaaggacgaagacatttactggtgt
actgccgatgtgggctggattaccggtcacagctatctggtttacggtccgctgctcaac
ggtgcaaccctgatgatgtatgaaggcgcaccgaactacccgcagtgggaccgcttctgg
gatattatcaaccgccacaaaatcaccattctctatactgctccgacggcgatacgggcg
tttatccgcgcaggtgacgagtgggtcaacaaacacgacctcagcacgctcagacttctc
ggcaccgttggtgaaccgatcaatccgaaagcatggatgtggtaccactccgttgtaggc
aaagaaaagtgtccgatcgtcgacacctggtggcagacagaaaccggaggcatcctggtc
tcgccccttcctggagcgaccccgacaaaaccgggcacggcaacccgtccgcttcccggt
atcctggtcgatgtcgttcgtaaggatggcacgccctgtaacgccaacgaaggcggctac
ctggtcatcaagaaaccatggccatcgatgcttcgcacgatttacggtgacaataaacgc
tatgaagagacctactggtctgaattcaaggatatgtatttcaccggtgatggcgcccgc
aaagacgaagatggctatatctggatcatgggacgcgtcgacgatgttgtcaacgtctcc
ggacaccgtcttggcaccagcgaagtagaaagcgctctcgttgcccacgaatctgtcgcc
gaagcagctgtcgtcagccgtccggatgagatcaagggcaacgctctgatcgcattcgtc
acgctcaaggatgaatatcagggcgacatgaaacttcgcgaggagttgagagcccatgtt
tccaaagagatcggcccgatagccaaacccgacgaaatcagatgggcccagggccttccc
aaaaccagaagcggcaaaatcatgcgccgacttctgcgcgaactggcctcaagcaaagag
atcaagggcgatgttaccacgcttgaagatttcggcgtgctcgaacagttgcgcggacag
gaagacgaagattaa

DBGET integrated database retrieval system