KEGG   Prosthecochloris aestuarii: Paes_0550Help
Entry
Paes_0550         CDS       T00732                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_0550
   01230 Biosynthesis of amino acids
    Paes_0550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_0550
   00030 Pentose phosphate pathway
    Paes_0550
   00051 Fructose and mannose metabolism
    Paes_0550
   00052 Galactose metabolism
    Paes_0550
  Energy metabolism
   00680 Methane metabolism
    Paes_0550
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Paes_0550
Enzymes [BR:paa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Paes_0550
Protein phosphatases and associated proteins [BR:paa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Paes_0550
Messenger RNA biogenesis [BR:paa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Paes_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(593009..594214)
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVIKGAAFMALSKGIEMYIIPNGYAGLYNLIDNEKLVLLDQAR
LDQFSGNFAGSEAGHSRVKIKAISNPEKYNRIKEGMKKFELDGLVVSGGDDSGSVMVDLN
SNGIHCIHAPKTMDLDLQTYSVGGDSTINRIAQFVQDLKTTGRTHNRILVTEVFGRYAGH
TAFRSGIAAEADCILIPEIPVDWDVVYEHIVGRFTRRIRQSDVSAGTYTIVVAEGMKNAD
GTDIIDESAGVDAFGHQKLAGAGKYVCQEMKKRLKADPDMPIFMKETGMFVEGIYEIPEI
REIHPGHLVRSGNTSAYDVNFGYEAGAAAVILLSEGKSGVTISKVKGRKIEYIESTKAIE
QRFVDLDQVALYESIGVCFGRHVAAYEPILREVDGVYDRIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattggcattctcaccagcggaggagactgcggcggtctcaacgcagtcatc
aaaggggcagcattcatggccctctccaaagggattgaaatgtatattatccccaacggc
tacgcaggactatacaaccttatcgacaatgaaaaactcgtactgctcgaccaggcacgt
ctggatcagttttccggaaacttcgcaggttcggaagcaggccattcgagggtgaaaatc
aaagccatcagtaatcccgagaagtacaaccgcatcaaagagggcatgaaaaagttcgaa
ctcgatggcctcgtggtcagcggaggtgatgattcgggtagtgtcatggtggacctgaac
agcaacggaattcactgtatccatgccccaaaaaccatggatctcgacctgcagacctac
tccgtcggtggagactcgaccatcaaccgtatcgcccagttcgttcaggacctgaaaacc
accggccgtacccataacagaattcttgtcaccgaagtattcggacgttatgccggccac
accgccttccgaagcggtatcgccgccgaagccgactgtatcctcatccctgaaatcccg
gtcgactgggatgtcgtctacgaacacattgtcggaagattcactcgccgcatccgccag
agtgacgtcagcgcaggcacctataccatcgtcgtcgctgaaggcatgaaaaacgccgac
ggtacggacattatcgatgaatctgcaggtgttgatgcctttggccatcaaaaacttgcc
ggcgccggtaaatatgtgtgccaggagatgaaaaagaggttaaaagccgacccggatatg
ccaattttcatgaaagaaaccggcatgttcgtcgaaggcatctacgaaatccccgaaatc
cgtgaaattcatccgggtcatcttgtccgttcaggaaacacctctgcctatgacgtcaac
ttcggctatgaagcaggagcagcagcggtcatactcctttccgaaggcaaatccggtgta
accatttccaaagtaaaaggacgcaaaatcgaatacattgaatccaccaaggccatcgaa
cagcgttttgtcgaccttgaccaggtagcgctgtatgagtcgatcggggtctgtttcggg
cgtcatgtcgccgcttatgagcctatcctcagagaggttgacggggtctatgacaggatt
tactga

DBGET integrated database retrieval system