KEGG   Prosthecochloris aestuarii: Paes_0607Help
Entry
Paes_0607         CDS       T00732                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
paa  Prosthecochloris aestuarii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_0607
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Paes_0607
   00640 Propanoate metabolism
    Paes_0607
   00660 C5-Branched dibasic acid metabolism
    Paes_0607
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Paes_0607
Enzymes [BR:paa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Paes_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(647427..648599)
Genome map
AA seq 390 aa AA seqDB search
MNIHEYQGKDILRKFGVSVPKGIVAFTAEEARQAAEQLFEEQENPVVVVKAQIHAGGRGK
AGGVKLAKSPDEVFDIARQMIGCTLVTHQTGPEGKEVRRLLVEEGMNIEKEFYVGITLDR
ATSQNVLMVSTEGGMEIETVAEETPEKLLKIQIHPLQGLQGFQARQAAFFLGLEGDKFKN
TVKFITALYKAYTAIDASIAEINPLVITKEGKVMALDAKINFDSNALFRHKDFLELRDIS
EEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMATMDMIQLAGGKPANFLDVGGSASPE
TVEEGFKIIMSDKNVKAILINIFGGIVRCDRVAGGVIEAAKKVGLDMPVIVRLEGTNAEI
AQKMLDESGLNLIAANGLREAAQKVNEALS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcagggcaaggatatactacgcaaattcggagtatccgtcccc
aaaggcattgtggcatttaccgccgaagaggctcgccaggctgcagaacagctttttgaa
gaacaggaaaatcctgttgtcgtcgtcaaggcacagatccatgccggaggcagaggaaaa
gccggaggagtcaagcttgcaaaatcacctgacgaggtcttcgacattgcacgtcagatg
attggctgcacccttgtgacccatcagaccggaccggaaggcaaagaggttcgtcgcctg
ctcgtcgaagagggcatgaatatcgaaaaagagttttatgtcggcattacgctcgaccgc
gccacatcccagaatgtgctgatggtctcgaccgaaggtggcatggaaatcgaaacagtc
gcagaagaaacccctgaaaaactgcttaaaatccagatccatccgcttcagggtcttcag
ggattccaggcacgacaggcggcttttttcctcggtctcgagggagacaagttcaaaaac
accgtcaaattcatcacagcgctctacaaggcctacaccgcaatcgatgcttcgattgct
gaaatcaacccgctggtcatcaccaaagagggaaaggttatggctcttgacgccaaaatc
aatttcgactccaacgcactcttccgccacaaggactttcttgaactgcgtgatatcagt
gaagaggacccgtttgaagtcgaagcatcgaaatcaaatctgaactacgtccggcttgac
ggcaatgtcggctgcatggtcaacggtgcaggtcttgcaatggcaacgatggacatgatc
cagcttgccggaggcaaaccggccaacttccttgacgtcggaggcagcgcgagccccgaa
accgttgaagaaggcttcaagatcatcatgagtgacaaaaacgtcaaagccatccttatc
aatatcttcggaggcatcgtccgttgcgaccgcgtagccggaggagttatcgaagccgcc
aaaaaggttgggctcgacatgccggtcatcgtccggctcgaaggcaccaatgccgaaatt
gcccagaaaatgcttgatgaatcagggctcaacctgatcgcagcaaacggtctgcgcgaa
gccgcacagaaagtcaacgaagcactttcctga

DBGET integrated database retrieval system