KEGG   Prosthecochloris aestuarii: Paes_0611Help
Entry
Paes_0611         CDS       T00732                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:paa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:paa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:paa00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:paa00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:paa00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
651866..652609
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNRENRFTGWRDIDLSEKGLAEAANAGVLMKEEGLTFDIAYTSVLKR
AIRTLWNALDTMDLLWVPVEKTWRLNERHYGSLQGLNKTETAQLHGEEQVLVWRRSYDTP
PPPLEKTDERYPGNDPRYASLSSEEIPVAECLKDTVARFLPYWHETIAPQIKAGKKVLIV
AHGNSLRALVKYLDNISEEDIVGINIPTGIPLVYELDDDLKPIRHYYLGDQEAAAKAAAA
VANQAKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactggtactgttacgacacggagaaagccagtggaacagggaaaaccgtttt
accggatggagagatattgatttaagcgaaaaagggctggctgaggccgctaatgccggc
gtgctgatgaaagaagaggggctgacatttgatatcgcttatacttctgtactcaaacga
gctattcggaccctgtggaacgcgcttgacacaatggaccttctgtgggttccggtagag
aaaacctggcgccttaacgagcgacattacggttcgcttcaggggctcaataaaacagaa
accgctcagcttcatggcgaagagcaggtgctggtctggagaagaagctatgatacgccg
ccgccgccgctcgaaaaaactgatgaacgctatcccggcaacgatccccgctatgcgtcc
ctctcttctgaagagattcctgttgcggaatgcctgaaggatacggttgcccgttttctt
ccctactggcatgagacgattgccccgcagatcaaggcgggaaagaaggtgctcatcgtt
gctcacggcaattcacttcgtgcgctggtaaagtatctcgacaatatttccgaggaggat
atcgttggtatcaacatcccgacggggattcctctcgtgtatgaactcgatgatgatctg
aagccgatccgccattattatcttggcgatcaggaggctgcggccaaagccgcggcagcc
gtcgccaatcaggccaaagggtaa

DBGET integrated database retrieval system