KEGG   Prosthecochloris aestuarii: Paes_0611Help
Entry
Paes_0611         CDS       T00732                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_0611
   01230 Biosynthesis of amino acids
    Paes_0611
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_0611
  Energy metabolism
   00680 Methane metabolism
    Paes_0611
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Paes_0611
Enzymes [BR:paa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Paes_0611
Exosome [BR:paa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Paes_0611
  Exosomal proteins of melanoma cells
   Paes_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
651866..652609
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNRENRFTGWRDIDLSEKGLAEAANAGVLMKEEGLTFDIAYTSVLKR
AIRTLWNALDTMDLLWVPVEKTWRLNERHYGSLQGLNKTETAQLHGEEQVLVWRRSYDTP
PPPLEKTDERYPGNDPRYASLSSEEIPVAECLKDTVARFLPYWHETIAPQIKAGKKVLIV
AHGNSLRALVKYLDNISEEDIVGINIPTGIPLVYELDDDLKPIRHYYLGDQEAAAKAAAA
VANQAKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactggtactgttacgacacggagaaagccagtggaacagggaaaaccgtttt
accggatggagagatattgatttaagcgaaaaagggctggctgaggccgctaatgccggc
gtgctgatgaaagaagaggggctgacatttgatatcgcttatacttctgtactcaaacga
gctattcggaccctgtggaacgcgcttgacacaatggaccttctgtgggttccggtagag
aaaacctggcgccttaacgagcgacattacggttcgcttcaggggctcaataaaacagaa
accgctcagcttcatggcgaagagcaggtgctggtctggagaagaagctatgatacgccg
ccgccgccgctcgaaaaaactgatgaacgctatcccggcaacgatccccgctatgcgtcc
ctctcttctgaagagattcctgttgcggaatgcctgaaggatacggttgcccgttttctt
ccctactggcatgagacgattgccccgcagatcaaggcgggaaagaaggtgctcatcgtt
gctcacggcaattcacttcgtgcgctggtaaagtatctcgacaatatttccgaggaggat
atcgttggtatcaacatcccgacggggattcctctcgtgtatgaactcgatgatgatctg
aagccgatccgccattattatcttggcgatcaggaggctgcggccaaagccgcggcagcc
gtcgccaatcaggccaaagggtaa

DBGET integrated database retrieval system