KEGG   Prosthecochloris aestuarii: Paes_0611Help
Entry
Paes_0611         CDS       T00732                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_0611
   01230 Biosynthesis of amino acids
    Paes_0611
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_0611
  Energy metabolism
   00680 Methane metabolism
    Paes_0611
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Paes_0611
Enzymes [BR:paa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Paes_0611
Exosome [BR:paa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Paes_0611
  Exosomal proteins of melanoma cells
   Paes_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
651866..652609
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNRENRFTGWRDIDLSEKGLAEAANAGVLMKEEGLTFDIAYTSVLKR
AIRTLWNALDTMDLLWVPVEKTWRLNERHYGSLQGLNKTETAQLHGEEQVLVWRRSYDTP
PPPLEKTDERYPGNDPRYASLSSEEIPVAECLKDTVARFLPYWHETIAPQIKAGKKVLIV
AHGNSLRALVKYLDNISEEDIVGINIPTGIPLVYELDDDLKPIRHYYLGDQEAAAKAAAA
VANQAKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactggtactgttacgacacggagaaagccagtggaacagggaaaaccgtttt
accggatggagagatattgatttaagcgaaaaagggctggctgaggccgctaatgccggc
gtgctgatgaaagaagaggggctgacatttgatatcgcttatacttctgtactcaaacga
gctattcggaccctgtggaacgcgcttgacacaatggaccttctgtgggttccggtagag
aaaacctggcgccttaacgagcgacattacggttcgcttcaggggctcaataaaacagaa
accgctcagcttcatggcgaagagcaggtgctggtctggagaagaagctatgatacgccg
ccgccgccgctcgaaaaaactgatgaacgctatcccggcaacgatccccgctatgcgtcc
ctctcttctgaagagattcctgttgcggaatgcctgaaggatacggttgcccgttttctt
ccctactggcatgagacgattgccccgcagatcaaggcgggaaagaaggtgctcatcgtt
gctcacggcaattcacttcgtgcgctggtaaagtatctcgacaatatttccgaggaggat
atcgttggtatcaacatcccgacggggattcctctcgtgtatgaactcgatgatgatctg
aagccgatccgccattattatcttggcgatcaggaggctgcggccaaagccgcggcagcc
gtcgccaatcaggccaaagggtaa

DBGET integrated database retrieval system