KEGG   Prosthecochloris aestuarii: Paes_0667Help
Entry
Paes_0667         CDS       T00732                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:paa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Paes_0667
Enzymes [BR:paa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Paes_0667
DNA repair and recombination proteins [BR:paa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Paes_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 Helicase_RecD PIF1 AAA_11 HHH_2 NTPase_1 T2SSE RsgA_GTPase AAA_16 ArgK cobW NACHT DUF2075 AAA_22 MobB HTH_IclR AAA_24 AAA_28 AAA_29 SRP54 AAA ABC_tran MMR_HSR1 ATPase_2 UvrD_C CbiA TsaE Sipho_tail Mg_chelatase UvrD-helicase ATP_bind_1 AAA_5 AAA_14 NB-ARC
Motif
Other DBs
NCBI-ProteinID: ACF45715
JGI: Paes0667
UniProt: B4S6G0
Position
703322..705508
Genome map
AA seq 728 aa AA seqDB search
MSSGTGGGMDERCTGVVERVVFHSQESGFTVLRVRIDECSDPVTVTGVLPVVSEGESVDG
RGSWVHDRRYGLQFQTVELAVVPPATEEGIERYLASGMVRGIGSHFARTLVRAFGPEVFS
VIEKDPERMLELPGIGKKRMQMVVEAWDEQKAVRDIMVFLQSHGVGTARAVRIYKTYGDQ
AIQIVSRNPYRLVLDIQGIGFRTADAIASTLGIEPNSLVRAQAGIRHVLVELSGDGHCAI
RRPELLSAALRLLGIGEEIISEALKEEIIRGAIVQEEIDGSECCFPANLFRAESTVASRI
ASLCGGKLPWGDVDADDAIAWVGTSTGLELSPSQASAVQTAVASKVLVITGGPGVGKTTL
VNSILSILKREDIKVALCAPTGRAAKRLSESTGMDASTIHRLLEFDPCSFDFKHNRTNPV
RADLVVVDEASMIDIVLMQKLLLAVPDDAALIIVGDVDQLPSVGPGSVLSDIITSGAVPV
VRLTEIFRQAEASRIIVNAHRINRGELPVNPESTETSDFYLVPASGPADIFSKVMQLVLE
RIPAKFAMDPVRDIQVLTPMNKGGLGTLALNSALQKALNPSSKDGISRFGTMFAQGDKVI
QQVNNYDKEVFNGDIGMISSLDADGKKLTVLFGSNTIDYEFGELDELSLAYATTIHKSQG
SEYPAVIIPLSMQHLMLLQRNLLYTAVTRGRRLVMVIAESNAVLKAVRNGSAGGRLTNLA
ERLRAEFR
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggtacaggtggagggatggatgagcggtgtacgggggttgtggaacgggtg
gtgtttcacagccaagagtcggggtttacggtgcttcgtgtgaggattgacgagtgtagt
gatcctgtaactgttactggcgtgcttcctgttgtttccgaaggggaatcggtcgatggt
cgcgggtcctgggttcacgaccggcgctatgggcttcagttccagactgttgagcttgcc
gtcgttcctccggctaccgaagaggggatcgagcgttacctggcttcaggtatggtgcgg
ggtatcggatcgcatttcgcaaggactctggtgcgggcattcgggccagaggttttttcg
gttatcgaaaaggatcctgagcggatgcttgaactgcccggtattggtaaaaagcggatg
cagatggtggtcgaagcctgggatgagcagaaagcagtgcgagatatcatggtgtttctt
cagtctcatggtgtcggaacggctcgtgccgtgaggatatataaaacctatggcgaccag
gctattcagatcgtgagccgtaatccatatcggcttgtgctcgatattcagggcatcggc
ttcagaacggctgatgcaatcgcatcgacccttggtatcgagccgaattctcttgtgagg
gcgcaggcaggtatacgtcatgtgctggtggagttgtcaggagatggtcactgtgccatt
cgtcgtccggaactgttatcggcagccctcagattgctgggcataggtgaagagatcatt
tcggaggctcttaaggaggagattattcgtggtgcgattgttcaggaggagatagatggc
tccgaatgctgttttccggcgaatctttttcgtgcagaaagcacagttgcatcgcggatt
gcctcattgtgtggcgggaaactgccgtggggtgatgtcgacgcagacgatgccattgca
tgggtgggaacgtctacggggcttgagttatcgccttcccaggccagtgcggtgcagact
gctgttgcgagtaaggttctggtcattaccggcggccccggtgtcggaaaaaccacgctt
gtcaattcgattctgagcattcttaaacgcgaagacatcaaagttgctttatgcgcccca
acgggcagagccgctaagcggctgagtgagtctacgggtatggacgccagcaccattcac
aggcttcttgagtttgatccttgttcttttgatttcaagcataaccggaccaatccggtc
agggctgatctggtggtcgttgacgaggcgtcgatgatcgatattgtcctcatgcagaag
cttctgctcgctgtgccggatgatgcggcactgattattgtaggggatgtcgatcagcta
ccgtcagtcggacccggctctgttctttccgatatcattacctccggtgcggttcccgtt
gttcgcctgacggagatcttccggcaggctgaggcttcccgcatcattgtcaacgcgcat
cgtattaatcggggagaactgccggtcaatcctgagagtacagagacatcggatttctat
ctggtgcctgcgtcaggtcccgcagatatcttttcgaaagtgatgcagcttgtgctcgag
agaattcctgcaaagtttgcaatggacccggtcagggatatacaggtgcttacccctatg
aacaagggcgggctgggaactcttgctctcaacagcgctcttcagaaggcgctgaaccct
tcaagcaaagacggcatcagccgcttcgggaccatgttcgctcagggcgataaggttatc
cagcaggttaataattatgataaagaggtttttaacggagatataggaatgatctcctca
ctcgatgccgatgggaaaaaactgacggtgttgtttggcagcaacactattgattatgag
ttcggcgagcttgatgaattgagcctggcttatgcgacaacgattcataaaagtcagggg
tccgagtatcccgccgttatcattcctctttccatgcagcatctgatgctgcttcagcgc
aacctgctctataccgctgtaaccagggggcggcggcttgttatggttattgccgagtcc
aatgcggtattgaaagctgtgcggaacggttctgccgggggacggttgacaaaccttgca
gaaaggcttcgtgcagagttccgatag

DBGET integrated database retrieval system