KEGG   Prosthecochloris aestuarii: Paes_0673Help
Entry
Paes_0673         CDS       T00732                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Paes_0673
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Paes_0673
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Paes_0673
Enzymes [BR:paa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Paes_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(715039..716241)
Genome map
AA seq 400 aa AA seqDB search
MTQHPYSAPDASGHFGTYGGKFIPETLVKNAADLEKEYQKARQDDQFWHEYNTLLSQYVG
RATPLYHAENLSKKTGGAKIFLKREDLCHTGAHKINNALGQALLARRMGKKRIIAETGAG
QHGVATATVCALFNLDCIVYMGQEDMKRQAPNVARMKLLGADVRPVTNGSRTLKDATSQA
IRDWINNPEETFYIIGSVVGMHPYPMMVRDFQSIIGKETKQQILQQTGKLPDVIAACVGG
GSNAIGMFYEFLPDARQIELVGVEAAGEGLTGLNAASLTLGKTGVLHGAMMKILQDNYGQ
ISEAHSISAGLDYPGVGPEHCHLQDLGLVTYTSATDQEALAALQTLAKTEGIICALESAH
AIHYGITRAAKMTPDQTIIVNLSGRGDKDMETIMREIRLD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacacccatattctgctcctgacgcatccggccatttcggaacctacggaggc
aaattcatacccgaaacgcttgtaaaaaacgctgccgacctggaaaaagaataccagaaa
gcaagacaggacgaccagttctggcatgagtacaacaccctgctgagccagtatgtcggt
cgcgctaccccgctctaccatgctgaaaacctatcgaagaaaacaggcggtgcaaaaatc
ttcctcaaacgagaagatctctgccacaccggagcgcataaaatcaacaacgcactcggc
caggctctgctcgctcgcagaatggggaaaaagagaataatagctgaaacaggagcaggt
cagcatggggtcgcgaccgcgacggtctgcgccctcttcaacctggactgcatcgtctac
atgggccaggaggacatgaaacgccaggcgcccaacgtcgcaagaatgaaactgctcggc
gccgacgtcagacccgttaccaacggcagccgcaccctcaaagatgcaacaagccaagcc
atcagggactggatcaacaaccccgaagaaacgttctacatcatcggttcagtcgtcggc
atgcacccctacccgatgatggtcagggattttcagtcgattatcggaaaagagacaaaa
cagcagatactccagcagaccggcaaacttcctgacgtcattgccgcctgtgtcggcgga
ggaagcaacgcgatcggcatgttctacgaatttctccccgacgcccgccagatagaactt
gtgggggtcgaagctgccggagaaggcctcaccggactgaatgccgcatccctcaccctt
ggaaaaacaggagtgctccacggagcaatgatgaaaattcttcaggataattacggacaa
atcagcgaagctcactcaatttctgcaggtcttgattaccccggcgtaggaccggaacac
tgccatctgcaggatctcggactggtcacctatacctcggcaacagaccaggaagccctc
gcagcactgcaaacacttgcaaaaaccgaaggcatcatctgcgccctcgaatcagcccac
gccatccattacggcatcaccagagccgcgaaaatgaccccagaccagaccatcatcgtc
aatctgtcaggcagaggagacaaagacatggaaacgatcatgcgagaaatccgtctggac
tga

DBGET integrated database retrieval system