KEGG   Prosthecochloris aestuarii: Paes_0693Help
Entry
Paes_0693         CDS       T00732                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00340  Histidine metabolism
paa01100  Metabolic pathways
paa01110  Biosynthesis of secondary metabolites
paa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Paes_0693
Enzymes [BR:paa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Paes_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACF45740
JGI: Paes0693
UniProt: B4S6I5
Position
736871..738157
Genome map
AA seq 428 aa AA seqDB search
MLPIFSYPEEQSDFQRHLSRSVTFEPEVQRVVQDILSDVAQRGDVALLDYTEKFQGIRPE
AFMVSQEEIEQAYLAADRAFVVVLEEAYDNITGFHRHEIDKSFFYEAGNRVILGQRVTPI
ERVMLYVPGGKAAYPSSLLMNVAPAQVAGVKEIFITTPCDDNGNVSEHVLVAAKVAGIDT
IYKFGGAQAVAAFAYGTESVPKVDKITGPGNKYVALAKKEVFGHVSIDSIAGPSEVVVIA
DRHADPEFVVLDMFAQAEHDPDAAAVCITDSAELAEAVRLLALEKVDTMVRSEVIRKALT
ANGAVVVVRDMAEACEVSNMLAPEHLELHVRNSWEILSDLKHAGAIFMGDYSCETIGDYY
AGPNHTLPTNGTARFFSPLSVRDFVKYSSIISYSAQELARTGERIAAFADHEGLQAHAEA
VRARLRKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgttaccgatattttcctatcccgaagaacaatctgattttcagcggcatctgagccgt
agcgtgacgtttgagcccgaggttcagcgtgtcgttcaggatattctttccgatgtcgca
cagcgcggcgacgtcgccctgcttgattacaccgaaaaatttcagggtatccggcctgaa
gccttcatggtttcacaagaagagatcgagcaggcgtatctggctgccgacagggcgttt
gtcgtcgttctcgaagaggcatatgacaatatcactggttttcaccgtcacgaaatcgat
aagagtttcttttacgaggcaggcaatcgggttattctcggccagagggtgactcctatc
gagcgcgttatgctctatgttcccggcggcaaggcggcttatccctcctcacttctgatg
aatgtcgctcctgcacaggttgcaggtgtgaaagagatttttattacgacgccctgcgat
gacaacggcaatgtcagcgagcatgttcttgtggctgcaaaagtggccgggatcgatacc
atttacaaatttggcggtgcccaggcggtggcggcatttgcttatgggacagaaagcgtg
ccgaaagtcgacaagattaccgggccaggcaacaagtatgtcgctctggcaaagaaagag
gttttcggacatgtttccatcgacagtatcgccggtccttccgaggttgtcgtgattgcc
gacaggcatgccgatccggagtttgtcgtgctggatatgtttgctcaggctgaacacgac
cctgatgcggcagcagtctgtataaccgattcagctgaacttgccgaagcggtccggttg
cttgccctcgagaaagtcgatactatggtccgttcggaggtgatccgaaaagcgcttaca
gccaatggagctgtcgttgtcgttcgtgatatggcagaggcttgcgaggtttccaatatg
cttgctcccgagcatcttgaactgcatgttcgtaacagctgggagatcctttccgatctg
aagcatgcaggtgcgatttttatgggtgattactcctgtgaaactattggtgattactat
gccggcccaaatcacacccttccaaccaacggtaccgctcgctttttctctccgctttcg
gtgcgtgattttgtcaaatattcatctattatttcctattcagcacaggaacttgccaga
acaggggaacgcatcgcggcgtttgctgatcatgaaggcctgcaggcgcatgcagaggct
gtgagggcgaggttgagaaagctatga

DBGET integrated database retrieval system