KEGG   Prosthecochloris aestuarii: Paes_0883Help
Entry
Paes_0883         CDS       T00732                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
paa  Prosthecochloris aestuarii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:paa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Paes_0883
DNA repair and recombination proteins [BR:paa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Paes_0883
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Paes_0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
963386..964000
Genome map
AA seq 204 aa AA seqDB search
MRYTSAAIESLIEEFAKLPGIGRKTAQRLAMHILHQHTDEVEKFASALIDVKQKVIHCRV
CQNVTDIGADPCAICCAKGRDRSVICVVETPSDVLAFEKTGQYRGLYHVLHGVISPLDGI
GPDDIGVKELLSRLSPDDGPRVSELIMALNPTVEGETTVLYISKLLKPLGVQVTKIARGI
PVGAELEFVDEATLSRALEGRSAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatacttctgcggcaattgaatcgctcatcgaagaatttgcgaaattgccgggc
attggcaggaaaacagctcagcgtcttgccatgcatatcctgcatcagcataccgatgag
gttgagaaatttgcgtctgccctgatcgatgtgaaacagaaagtgattcactgccgagtg
tgtcagaacgtgactgatattggtgcagatccctgtgcaatatgttgcgccaaaggccga
gacaggtcggttatctgcgtggttgaaactccttcggatgtgctggcttttgaaaaaaca
gggcagtacagaggattgtatcatgtattgcatggtgttatttccccgcttgacggaata
ggtccggatgatattggcgtcaaggaactcctttcgcgtctttctcctgacgatggcccc
cgggtgagtgagcttatcatggcattgaaccccacggttgagggagagacgacagttctc
tatatcagtaaactgctcaagccacttggtgttcaggtaacaaagatcgccagaggtatt
cctgtaggggcggaacttgagtttgtcgacgaagcaacgctttcgagggctctggaagga
cgctcggcgttgtga

DBGET integrated database retrieval system