KEGG   Prosthecochloris aestuarii: Paes_1033Help
Entry
Paes_1033         CDS       T00732                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
paa  Prosthecochloris aestuarii
Brite
Enzymes [BR:paa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Paes_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1135460..1136458
Genome map
AA seq 332 aa AA seqDB search
MHKKVLVTGATGFIGSRLVRKLVSGDNEVYALVRKSSSLVSFSGILDRVRLVEGDVTDPD
SLKKAFEGMDRIYHSAGYTYMGGDSSRDATLNAINVQGSRNVFDAALEAGVERVVHVSSI
TAVGFSSNRKPLNESFTWNFDQIQLKYAETKHLAEEEAQKAVARGLDCVIVNPAFVFGAG
DVNFNAGRIIKDVYEGKMPVYPLGGVSVVDVEIVVETTIRAMEVGRCGERYIIGGDNISY
KQLAGTISSVTGASAFRFPLPFWMASPLLYLMKRLNFRKKVSKLFNLSMFRVASEFLYFD
SSKAIRELGMKSEPHEFSIRRAFEWYRKEGLL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgcataaaaaagtattagtaaccggagcaaccggttttattggttctcgtcttgtaaga
aaactggtctccggtgacaatgaggtctatgctctggttcgcaaaagctcgagtcttgtt
tcgttttcggggattctcgacagggttcgtctcgttgaaggtgatgtgacggaccctgat
tctctcaaaaaagcgtttgagggaatggaccggatttatcattccgccggatatacctat
atgggcggagactcaagcagggacgccacgttaaacgctattaacgttcagggatcgcgc
aatgtctttgatgcggctcttgaggcgggcgtcgaacgtgttgttcatgtcagttcgatt
acagcagtagggttttcttcgaaccgtaagccgctcaatgaatcatttacgtggaatttt
gatcagattcagctgaaatatgctgaaaccaaacaccttgcagaagaggaggctcaaaag
gccgttgccagaggtctggattgtgtgattgtcaatcctgcgtttgttttcggagcgggc
gatgtgaatttcaacgcgggcaggatcatcaaggatgtctatgaggggaaaatgccggtc
tatcccttggggggtgtttctgtcgtggatgtcgagatagtcgttgaaacgacgatacgg
gctatggaagtcgggaggtgtggcgaacgatatattatcggaggcgacaacatttcctat
aaacagctggcagggacgatttcaagcgttaccggagcatcagcgtttcgttttcccctt
cctttctggatggccagtccgttgctttatcttatgaaaaggttaaattttcgtaagaag
gtctcgaagctcttcaatctttcgatgttcagagtcgcgtctgaatttttgtattttgat
tcatcaaaggctattcgtgaactcggcatgaaatccgaaccgcatgagttcagtatcaga
agagcttttgaatggtacaggaaagaaggccttctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system