KEGG   Prosthecochloris aestuarii: Paes_1068Help
Entry
Paes_1068         CDS       T00732                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00010  Glycolysis / Gluconeogenesis
paa00030  Pentose phosphate pathway
paa00051  Fructose and mannose metabolism
paa00052  Galactose metabolism
paa00680  Methane metabolism
paa01100  Metabolic pathways
paa01110  Biosynthesis of secondary metabolites
paa01120  Microbial metabolism in diverse environments
paa01130  Biosynthesis of antibiotics
paa01200  Carbon metabolism
paa01230  Biosynthesis of amino acids
paa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_1068
   00030 Pentose phosphate pathway
    Paes_1068
   00051 Fructose and mannose metabolism
    Paes_1068
   00052 Galactose metabolism
    Paes_1068
  Energy metabolism
   00680 Methane metabolism
    Paes_1068
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Paes_1068
Enzymes [BR:paa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Paes_1068
Protein phosphatases and associated proteins [BR:paa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Paes_1068
Messenger RNA biogenesis [BR:paa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Paes_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACF46103
JGI: Paes1068
UniProt: B4S7R6
Position
complement(1176763..1177806)
Genome map
AA seq 347 aa AA seqDB search
MTISAMRDLSMTPATENGLRRKPILRKIGVFTSGGDAPGMNAAIRAVTRAAIANKLKVTG
IRRGYQGMIEGDFIPLRSSDVSGIIQLGGTILRTARSKEFRTPEGREKAWQQLQNAGIDA
VVVIGGDGSFTGALTMSQEYNISFVGIPGTIDNDIYGTDYTIGYETALNSVVCAVDKIRD
TAVSHGRIFMVEVMGREAGLLALNSGIACGAEVILIPESKEQHDALKRFLDKGYKRKERS
GIVIVAEGDEPGGALKLAENVRCEHPELDVRVSILGHIQRGGSPTANDRINATRMGVAAV
DALLDDQKSIMIGIDNGRIVQVPFNKAVKLNHSFDRELLEIQKMLNI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttcagcaatgagagatctatctatgacacctgcaacagagaacggattacgc
agaaaaccaatactacgaaaaataggagtatttacttctggcggggatgctcccggtatg
aatgccgctatccgcgcggtcactcgtgcggcaatcgcgaacaagctgaaagtcaccgga
attcgccggggataccagggaatgatcgagggcgattttattccgttgcgctcatcggat
gtcagcggcatcatccagctgggaggaacaattctcagaacggcacggagcaaggagttc
agaactcccgaaggccgggaaaaagcctggcagcagttgcagaacgcgggcatagacgct
gttgttgtgatcggtggcgacggctcttttaccggtgcgctgacaatgtctcaggagtac
aatatatcgttcgtaggtattccgggcaccatcgacaacgacatatacgggacggactat
accatcggatatgaaacggcattgaactccgttgtgtgcgcggtcgacaaaatcagggat
acggcagtatcacacggcaggattttcatggttgaggtgatgggccgggaagcaggcctg
cttgccctgaacagcggcattgcctgcggggcggaagtcattctgattcctgaatcgaaa
gagcagcatgatgcgttgaagcggtttctcgacaagggctataagcgcaaggagcgaagc
ggcatagttatcgttgccgaaggggatgaaccgggaggagcgttgaaacttgccgaaaac
gtgcgctgtgagcatcccgaacttgatgttcgcgtttcgatcctgggccatattcagcga
ggaggaagcccgacggcaaacgaccgcatcaatgcgacgagaatgggagttgctgctgtc
gatgccctgctcgacgatcagaaaagcatcatgatcgggattgacaacggaaggatcgtg
caggtcccgttcaacaaggccgtcaagctgaatcacagtttcgacagggaattactggag
atacagaaaatgctcaacatctga

DBGET integrated database retrieval system