KEGG   Prosthecochloris aestuarii: Paes_1068Help
Entry
Paes_1068         CDS       T00732                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_1068
   01230 Biosynthesis of amino acids
    Paes_1068
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_1068
   00030 Pentose phosphate pathway
    Paes_1068
   00051 Fructose and mannose metabolism
    Paes_1068
   00052 Galactose metabolism
    Paes_1068
  Energy metabolism
   00680 Methane metabolism
    Paes_1068
Enzymes [BR:paa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Paes_1068
Protein phosphatases and associated proteins [BR:paa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Paes_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1176763..1177806)
Genome map
AA seq 347 aa AA seqDB search
MTISAMRDLSMTPATENGLRRKPILRKIGVFTSGGDAPGMNAAIRAVTRAAIANKLKVTG
IRRGYQGMIEGDFIPLRSSDVSGIIQLGGTILRTARSKEFRTPEGREKAWQQLQNAGIDA
VVVIGGDGSFTGALTMSQEYNISFVGIPGTIDNDIYGTDYTIGYETALNSVVCAVDKIRD
TAVSHGRIFMVEVMGREAGLLALNSGIACGAEVILIPESKEQHDALKRFLDKGYKRKERS
GIVIVAEGDEPGGALKLAENVRCEHPELDVRVSILGHIQRGGSPTANDRINATRMGVAAV
DALLDDQKSIMIGIDNGRIVQVPFNKAVKLNHSFDRELLEIQKMLNI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttcagcaatgagagatctatctatgacacctgcaacagagaacggattacgc
agaaaaccaatactacgaaaaataggagtatttacttctggcggggatgctcccggtatg
aatgccgctatccgcgcggtcactcgtgcggcaatcgcgaacaagctgaaagtcaccgga
attcgccggggataccagggaatgatcgagggcgattttattccgttgcgctcatcggat
gtcagcggcatcatccagctgggaggaacaattctcagaacggcacggagcaaggagttc
agaactcccgaaggccgggaaaaagcctggcagcagttgcagaacgcgggcatagacgct
gttgttgtgatcggtggcgacggctcttttaccggtgcgctgacaatgtctcaggagtac
aatatatcgttcgtaggtattccgggcaccatcgacaacgacatatacgggacggactat
accatcggatatgaaacggcattgaactccgttgtgtgcgcggtcgacaaaatcagggat
acggcagtatcacacggcaggattttcatggttgaggtgatgggccgggaagcaggcctg
cttgccctgaacagcggcattgcctgcggggcggaagtcattctgattcctgaatcgaaa
gagcagcatgatgcgttgaagcggtttctcgacaagggctataagcgcaaggagcgaagc
ggcatagttatcgttgccgaaggggatgaaccgggaggagcgttgaaacttgccgaaaac
gtgcgctgtgagcatcccgaacttgatgttcgcgtttcgatcctgggccatattcagcga
ggaggaagcccgacggcaaacgaccgcatcaatgcgacgagaatgggagttgctgctgtc
gatgccctgctcgacgatcagaaaagcatcatgatcgggattgacaacggaaggatcgtg
caggtcccgttcaacaaggccgtcaagctgaatcacagtttcgacagggaattactggag
atacagaaaatgctcaacatctga

DBGET integrated database retrieval system