KEGG   Prosthecochloris aestuarii: Paes_1089Help
Entry
Paes_1089         CDS       T00732                                 

Definition
ATP-grasp domain-containing protein
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
paa  Prosthecochloris aestuarii
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_1089
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Paes_1089
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Paes_1089
Enzymes [BR:paa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Paes_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1198539..1199738
Genome map
AA seq 399 aa AA seqDB search
MAKILEGSAMKFFNKWGIPVPNYVVVMDPNRLAQLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKLGLNLEEAVEASREMIGRKIGTAEIRQVIVAEMLDHDEEYYVSIAGNPDGAELLL
SSKGGVDIEDNWDTVQRIHIPIDETPSLEALTDLATKAGFGDQEIAERVAKIASRLILCY
DNEDAQSIEINPLVIRKSDMRFAALDAVMNVDWDARFRHPDWDFKPVSEIGRPFTEAEQQ
IMDIDSRIKGSVKFVEVPGGEVALLTAGGGASVFYADAVVARGGSIANYAEYSGAPPDWA
VEALTETLCQLPNIKHIIVGGAIANFTDVKATFGGIINGLRESKANGYLDGVKIWVRRGG
PNESEGLAAISKLKDEGFDIHVYDRNIPMTDIVDMAMNV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatacttgaagggtcggcaatgaagtttttcaacaagtggggcattccggtg
ccaaactatgttgttgtcatggacccgaacagactggctcagctgggcgaggccaacaag
tggcttagagaatcaaaacttgttgtcaaagctcatgaggccatcggtggcagattcaag
ctcgggcttgtaaaactcgggctcaacctcgaagaagctgtcgaagcatccagagagatg
atcggaaggaagatcggtactgccgaaatccgccaggttattgtggccgaaatgcttgac
catgatgaagagtactatgtttcaatagcaggcaatcctgatggagcggagcttctgctt
tcatccaaaggcggcgttgatattgaagataactgggataccgtccagagaattcacatt
cctatcgatgaaactccatcgcttgaagcgttgaccgaccttgcgacaaaagccgggttc
ggtgatcaggagattgctgagcgggtcgcaaaaattgcatcgagacttattctttgttat
gataatgaagatgcgcagtcaatcgaaatcaatccgcttgttatccgcaagagcgatatg
cgtttcgctgcccttgacgcggttatgaatgtcgactgggacgcacgtttccgccatcct
gactgggatttcaaacctgtttccgagattggtcgtccgtttacagaagctgagcagcag
atcatggatatcgactccagaatcaaaggttctgtgaagtttgtcgaggttccgggtggc
gaagttgctcttctcaccgctggcggcggcgcttcggtgttctatgccgatgctgttgtg
gctcgtggaggttcgattgccaactacgctgaatattccggtgctcctcccgactgggca
gttgaggcgctgaccgaaaccctttgccagctccccaatatcaagcatatcattgttggc
ggcgctattgctaactttaccgatgtgaaagctacgtttggcggtattatcaacggcctg
cgtgagagcaaggcaaacggctatcttgatggagtcaaaatctgggttcgccgtggcggc
ccgaatgaaagcgaaggtcttgccgctatcagcaaactcaaggatgaaggttttgacatc
catgtttacgatagaaatattcctatgaccgatattgttgatatggctatgaacgtctga

DBGET integrated database retrieval system