KEGG   Prosthecochloris aestuarii: Paes_1438Help
Entry
Paes_1438         CDS       T00732                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00860  Porphyrin and chlorophyll metabolism
paa01100  Metabolic pathways
paa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Paes_1438
Enzymes [BR:paa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Paes_1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 MCM AAA_22 AAA_33 Sigma54_activat AAA AAA_29 DUF815 AAA_18 AAA_30 AAA_19 ABC_tran MMR_HSR1 AAA_28 FtsK_SpoIIIE AAA_14 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ACF46458
JGI: Paes1438
UniProt: B4S8S1
Position
complement(1568879..1570030)
Genome map
AA seq 383 aa AA seqDB search
MTQTASAAKKTASTKAKAGTGVQETSGPKKARTKKKQGQAFPFTAIVGQEEMKLSLILNI
IDPRIGGVLVMGHRGTGKSTTVRALAEVLPSIERVKDDVYNRTVSQYIEMEKTDKSGKAL
KPEGMTVEDIQVPVVDLPLGATEDRVCGTIDIEQALTSGVKAFEPGLLAQANRGFLYIDE
VNLLDDHLVDVLLDVAASGRNVVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGLH
ARIITITDIERRVEIVKRRREFDDNPPAFLKKWVKEQKKLQDQILKAKTLLPKITMHDDV
LTDIARLCMQLGIDGHRGELTITRTAHAFAAFKGDKEVTMEHVKEISGLALRHRLRKDPL
ETLDAGEKIERELAKVLGEAEEV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaactgcttcagctgcaaagaaaacagcaagtacaaaggccaaagctggtacg
ggtgttcaggagacttccggacccaaaaaagcaagaaccaaaaagaagcaaggccaagcg
tttccttttaccgctattgtcggtcaggaggaaatgaaattgagtctgatcctcaatatc
attgatccgaggatcggcggtgtgcttgtcatgggacacagaggtactggtaaaagtaca
actgttcgggcgctggcggaagtgcttccttcaattgaaagagtaaaagacgatgtctac
aaccgtacggtcagtcagtacatcgaaatggaaaaaactgacaagagcggcaaagcgctc
aagccggaaggcatgacggttgaggatattcaggttcctgttgtcgaccttcctctcggt
gcaactgaagaccgtgtttgcggtacgatcgatatcgaacaggcattgaccagcggtgtc
aaggcttttgagccgggtcttcttgctcaggctaaccgcggttttctctatattgacgag
gtcaaccttcttgatgatcaccttgtcgacgttcttcttgacgtagcagccagcggcaga
aacgttgttgagcgtgaaggtatcagtatccgtcaccctgccagattcgtgcttgtcggt
tcaggtaaccctgaagagggcgaactcaggccgcagcttctcgatcgtttcggtctgcat
gcacgcattatcactattaccgatatcgaaagacgggttgagatcgtgaagcgtcgtcgt
gagtttgacgataatccgccggcatttctcaaaaaatgggtcaaggaacagaaaaaactt
caggaccagattctcaaagcaaagactcttctgccgaaaatcaccatgcatgacgatgtg
ctgactgatattgcaaggctctgtatgcagctgggtattgacggccatcgcggtgaactg
accattaccagaacagctcacgcattcgcagccttcaaaggtgacaaagaggtgactatg
gagcatgtcaaagagatttccgggctagcgcttcgtcaccgtttgcgcaaagatccgctc
gagactctcgacgctggtgaaaaaatcgaacgtgaacttgcaaaagtgcttggagaagca
gaagaagtataa

DBGET integrated database retrieval system