KEGG   Prosthecochloris aestuarii: Paes_1562Help
Entry
Paes_1562         CDS       T00732                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_1562 (tpiA)
   01230 Biosynthesis of amino acids
    Paes_1562 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_1562 (tpiA)
   00051 Fructose and mannose metabolism
    Paes_1562 (tpiA)
   00562 Inositol phosphate metabolism
    Paes_1562 (tpiA)
Enzymes [BR:paa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Paes_1562 (tpiA)
Exosome [BR:paa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Paes_1562 (tpiA)
  Exosomal proteins of bladder cancer cells
   Paes_1562 (tpiA)
  Exosomal proteins of melanoma cells
   Paes_1562 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1701451..1702209)
Genome map
AA seq 252 aa AA seqDB search
MRKKIVVGNWKMNKTIAEAVELSSAIIDQLGEVSASCEVGIAPAFPALSGVHGVISGTGI
HLAAQNCHYEDDGAFTGEVSVRMLDEAGCSYVIVGHSERRQYFGDTNPVVNLKVKKALSA
GLNVILCVGETLDEREKGITTEVVTCQVKEGLEGVADIGDIVIAYEPVWAIGTGKTASSL
QAQEVHASIRATVAGLYSEPAAAGVRIQYGGSVKPSNAEELFAMPDIDGGLIGGASLNAE
DFVAIVKAAEKS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaaattgttgttggtaactggaaaatgaataagaccatcgctgaggcggtt
gagctttcgtctgctattattgatcagctcggcgaagtttcagcttcgtgtgaggtaggc
atcgctccggcttttcctgcattgagcggtgtacatggtgttatcagtgggaccggcatc
catcttgcggctcagaactgtcactatgaggatgacggtgcttttaccggagaggtttct
gtccgtatgcttgatgaggcaggatgcagctatgtgatcgtcggacattccgaacgtcgg
cagtatttcggtgatactaatccggtcgtcaatctcaaagtcaaaaaagcgctctctgct
ggcctgaatgtcattctttgcgttggagagactctggatgagcgtgaaaaggggattact
acagaggtggtgacctgccaggtgaaagaggggcttgaaggtgttgctgatatcggggat
atcgttattgcctatgagccggtatgggctattggtaccgggaaaacagccagtagcctg
caggcgcaggaggtgcatgcttctatccgcgcgaccgtcgccggcctctacagcgagcct
gctgcagccggagtgcggatccagtatggcggaagcgtcaaaccctccaatgccgaagaa
ctttttgccatgcctgatattgacggcggtcttatcggcggagccagtctcaacgctgaa
gactttgtcgctatcgtcaaagcagcagagaagagttga

DBGET integrated database retrieval system