KEGG   Prosthecochloris aestuarii: Paes_1562Help
Entry
Paes_1562         CDS       T00732                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00010  Glycolysis / Gluconeogenesis
paa00051  Fructose and mannose metabolism
paa00562  Inositol phosphate metabolism
paa01100  Metabolic pathways
paa01110  Biosynthesis of secondary metabolites
paa01120  Microbial metabolism in diverse environments
paa01130  Biosynthesis of antibiotics
paa01200  Carbon metabolism
paa01230  Biosynthesis of amino acids
Module
paa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_1562
   00051 Fructose and mannose metabolism
    Paes_1562
   00562 Inositol phosphate metabolism
    Paes_1562
Enzymes [BR:paa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Paes_1562
Exosome [BR:paa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Paes_1562
  Exosomal proteins of bladder cancer cells
   Paes_1562
  Exosomal proteins of melanoma cells
   Paes_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACF46580
JGI: Paes1562
UniProt: B4S9B0
Position
complement(1701451..1702209)
Genome map
AA seq 252 aa AA seqDB search
MRKKIVVGNWKMNKTIAEAVELSSAIIDQLGEVSASCEVGIAPAFPALSGVHGVISGTGI
HLAAQNCHYEDDGAFTGEVSVRMLDEAGCSYVIVGHSERRQYFGDTNPVVNLKVKKALSA
GLNVILCVGETLDEREKGITTEVVTCQVKEGLEGVADIGDIVIAYEPVWAIGTGKTASSL
QAQEVHASIRATVAGLYSEPAAAGVRIQYGGSVKPSNAEELFAMPDIDGGLIGGASLNAE
DFVAIVKAAEKS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaaattgttgttggtaactggaaaatgaataagaccatcgctgaggcggtt
gagctttcgtctgctattattgatcagctcggcgaagtttcagcttcgtgtgaggtaggc
atcgctccggcttttcctgcattgagcggtgtacatggtgttatcagtgggaccggcatc
catcttgcggctcagaactgtcactatgaggatgacggtgcttttaccggagaggtttct
gtccgtatgcttgatgaggcaggatgcagctatgtgatcgtcggacattccgaacgtcgg
cagtatttcggtgatactaatccggtcgtcaatctcaaagtcaaaaaagcgctctctgct
ggcctgaatgtcattctttgcgttggagagactctggatgagcgtgaaaaggggattact
acagaggtggtgacctgccaggtgaaagaggggcttgaaggtgttgctgatatcggggat
atcgttattgcctatgagccggtatgggctattggtaccgggaaaacagccagtagcctg
caggcgcaggaggtgcatgcttctatccgcgcgaccgtcgccggcctctacagcgagcct
gctgcagccggagtgcggatccagtatggcggaagcgtcaaaccctccaatgccgaagaa
ctttttgccatgcctgatattgacggcggtcttatcggcggagccagtctcaacgctgaa
gactttgtcgctatcgtcaaagcagcagagaagagttga

DBGET integrated database retrieval system