KEGG   Prosthecochloris aestuarii: Paes_1620Help
Entry
Paes_1620         CDS       T00732                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00030  Pentose phosphate pathway
paa01100  Metabolic pathways
paa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Paes_1620
Enzymes [BR:paa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Paes_1620
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Paes_1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP E1_dh
Motif
Other DBs
NCBI-ProteinID: ACF46638
JGI: Paes1620
UniProt: B4S9G8
Position
complement(1762093..1764489)
Genome map
AA seq 798 aa AA seqDB search
MSDAVCDQGFLQPLSAEQLERINAYWRAANYLSVGQIYLMDNPLLRVPLRAEHVKPRLLG
HWGTTPGLNFIYAHLNRVIRARDLNLIYIAGPGHGGPALVANVWMEGTYSQYYPDVSFDE
QGMKRLFRQFSFPGGIPSHVAPETPGSINEGGELGYCLSHAFGAVFDNPDLVAACVIGDG
EAETGPLAAAWHSNKFLNPRRDGAVLPVLHLNGYKIANPTILARLPRQELERLMRGYGYN
PCFVEGSDPFVMHQAMAAAMDNCFDEIREIQRQARQEEGVVKRPLWPMIVLRSPKGWTGP
KEVDGKKTEDFWRSHQVPFAAVRENPDHLKLLESWMKSYRPEELFTSEGELIAELRELAP
TGRRRMGDNPHANGGVLLQGLHMPDFQDYAVKVPEPGSVIAEAPIPMARFLRDVMRLNES
AANFRVFGPDETASNRLGDLFEETDRAWMAEIIADDDHLSPDGRVMEILSEHTCQGWLEG
YLLTGRHGFFSCYEAFIHIIDSMFNQHAKWLKVTNDEIPWRRPIASLNYFLTSHVWRQDH
NGFSHQDPGFIDHVVNKKADVIRVYLPPDANTLLSITDHCLRSRNYINVIVAGKQPAFQW
LDMDSAVKHCSSGIGIWEWASSDIEDGDPDVVMACAGDVPTLETLAAVDILRSQLPDLKI
RVVNVIDLMTLQPQEEHPHGLPDRHFDDIFTTDKPVIFAYHGYPWLIHRLTYRRTNHRNL
HVRGYKEEGTTTTPFDMVVMNDLDRFHLVADVVDRVPRLRQRAAYVKQYVRDRLIEHKQY
IRTYGEDMPEIREWKWNW
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgcagtctgtgatcaaggttttctgcagcctctttctgctgaacagcttgaa
cgtatcaatgcatactggagggcggctaattatctttcggttggtcagatctatcttatg
gataaccctcttcttcgggttccactgcgtgcggagcatgtcaaaccgcgacttctgggg
cactggggaacgacgcccggcttgaacttcatctatgcgcatctcaatcgtgttatcagg
gcgcgtgatctcaatctgatttatattgccggccctggccatggtggtccggcgcttgtg
gccaatgtctggatggaagggacgtacagtcaatattatcctgatgtttctttcgatgaa
caggggatgaaacgacttttccgtcagttttcatttcccggcggcataccgagccatgtt
gccccggaaacgcccggttcaatcaacgagggtggggaacttggctattgtctctctcac
gccttcggagctgttttcgacaaccctgatcttgtcgcggcatgcgtcatcggagacggt
gaggcagaaacaggccctcttgcagcagcatggcacagcaataaatttctcaatcccagg
cgcgacggagcggtgctgccggtgctgcatctcaatggctataaaatcgccaatcctacg
attcttgcccgtttaccccgacaagagcttgagcgtcttatgcgcggatatggatataac
ccctgttttgtcgagggcagtgatcctttcgtcatgcatcaggctatggcggctgccatg
gacaactgttttgacgagattcgagagattcagaggcaggcaaggcaggaggagggggtc
gtcaagcgtcctctttggccgatgatcgtcctgcgctctccaaaaggatggacagggcca
aaagaggtcgacggcaagaagactgaggatttctggcgttcccatcaggtgccgtttgct
gcggtgagagaaaatccggaccatttgaagctgctcgaatcgtggatgaaaagctacagg
cccgaggagctctttacatcggagggggagcttatagctgaacttcgcgagcttgctccg
accgggagacgtcgaatgggagataatcctcatgccaacgggggagtgcttctgcagggg
ttgcatatgcctgattttcaggactatgccgtcaaggttcccgagccgggttctgtgatc
gccgaggcaccgataccgatggcccggtttctgcgcgatgtgatgcggctcaacgaatca
gcagcgaatttcagggttttcggtcctgatgaaacggcctcaaaccgccttggcgatctt
tttgaagagactgatcgcgcctggatggctgagattattgctgatgatgaccatctttca
cctgatggccgtgttatggagatcctttcggagcatacctgccagggatggctggagggc
tatctgctgaccggtcggcacggttttttttcctgttatgaggcgtttattcatatcatt
gattccatgttcaatcagcatgccaagtggctgaaggtgaccaacgatgaaattccatgg
agacggccgattgcatcgctcaactattttctgacatcgcacgtctggcgtcaggaccat
aacggtttttcgcatcaggatccaggttttatcgatcatgttgtcaataaaaaggctgat
gtcatccgtgtctatcttccgcccgatgccaatactctgctctccataacggatcactgt
cttcgttcgcgcaactatatcaacgtgattgttgccggtaagcagcccgcgttccagtgg
cttgatatggattcggccgttaaacactgttcaagtggtatcgggatatgggagtgggcg
tcgagcgatatcgaagacggagatcctgatgtggttatggcctgcgccggcgatgttcct
acgcttgagacgctcgctgcagttgatattctccgttcacaactgcccgatctgaagatt
cgggtcgtgaatgtgatcgacctgatgaccctgcagccgcaggaggaacatcctcacggg
cttccggaccggcattttgatgacatttttaccacggataagcctgtgatttttgcctat
cacggctatccctggctgatccaccggctcacctatcgcaggaccaatcatcgaaatctc
catgtgcggggatacaaggaagaagggacgactacaacgccattcgatatggtggtgatg
aacgatctcgaccgttttcatctggttgccgatgttgtcgacagggtgcctcgactgcgt
cagagggcagcgtatgtcaagcagtatgtgcgagaccggctgatcgaacataagcagtat
attcgaacgtatggagaggatatgcctgagatccgtgaatggaaatggaactggtga

DBGET integrated database retrieval system