KEGG   Prosthecochloris aestuarii: Paes_1750Help
Entry
Paes_1750         CDS       T00732                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
paa  Prosthecochloris aestuarii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Paes_1750
Enzymes [BR:paa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Paes_1750
Transfer RNA biogenesis [BR:paa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Paes_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1909919..1910710)
Genome map
AA seq 263 aa AA seqDB search
MSASLLTESLVQTAIDAALKAGAEILGIYSRDDHGVELKGDDSPLTLADKAAHRVIMQML
QDTALPVLSEEGRNIPYVERAQWERFWMVDPLDGTKEFISRNGEFTVNIALVEHGKPVMG
VVYVPVLDELYVGKAGRGALLIRNAAAEPWETVTLPCGAAGDGVYRVVGSRSHLNDETLA
FVEELRAEHPEIEMVQRGSSLKICMVAAGDADCYPRFGLTMEWDTAAGHAVVNAAGKRMV
IAGSDDEVRYNKEDLLNPFFIVR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatcactgctgacagagtcgcttgttcagacagccatagatgctgcgctcaag
gctggtgccgagatactggggatatatagccgggatgatcacggtgttgagctcaagggc
gatgactcaccgttgacgctggctgacaaggcagcgcatagggtgatcatgcagatgctt
caggacacagctttgccggtgctgagtgaagaggggcgcaatattccttatgttgagcgt
gcacagtgggaacggttctggatggttgatccccttgacgggaccaaggagtttatttcc
aggaacggagagtttacggtgaacattgcgctggtcgagcatggcaagcctgtgatgggt
gtggtgtatgtgccggtactcgatgagttgtatgttggtaaggcggggcggggcgcgctg
ttgattcgcaatgctgctgctgaaccatgggaaacggtaacgttaccttgtggtgctgct
ggtgatggtgtgtatcgtgtggttggtagtcgttcccatcttaatgatgagacgcttgcg
tttgtggaagagcttcgtgctgagcatccggagattgagatggtgcagcggggaagttcg
ctgaaaatctgcatggtggcagccggtgatgccgattgctatccacggttcggccttacc
atggagtgggatactgcggctgggcatgctgttgtgaatgctgcgggaaaacgaatggtt
attgccggcagtgatgatgaggtgcggtataataaggaggatctgttgaatccgtttttt
attgttaggtga

DBGET integrated database retrieval system