KEGG   Prosthecochloris aestuarii: Paes_1952Help
Entry
Paes_1952         CDS       T00732                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
paa  Prosthecochloris aestuarii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2133617..2134642)
Genome map
AA seq 341 aa AA seqDB search
MQDKDTLGQSGRVILVTGATGYIGSELVERLSSLCDAGLHLRVLARRGSDVSVLDGNSVE
FVYGDLLDSLSLYDACSGVDTVFHCAGLIAYSRNYRQRLYATNVTGTGNLVNACLAEGVT
RLVHTSSVAAAGVGDDGEPADETTPFREWQHRIAYMESKHLAEMEGRRGIAEGLDVVFVN
PGVVIGTPSNPAGRLNSSSRAIRDIYRGTIPVYPSGGISLVDIGDVADAHLAAWRHGRSG
QRYLVTAGNYSFRQLFAMIAAMPGSAAGKAYQAASVVESVVGVAGELFALLTGSRPYLSV
ESMRLARTLLYYSNRLSVEELGMQYRPVEETLRSIVSQAAV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcaggataaagataccttgggacaaagcgggcgggttatactggttaccggagcgacc
ggttatataggatcggagttggttgaaaggctcagttccctctgcgatgccgggttgcat
ctcagggtgcttgctcgcagaggatccgatgtttcggttcttgacggcaacagcgttgag
tttgtgtacggtgatcttcttgattccctttccctctatgatgcctgcagcggggtcgat
acggtttttcattgcgcaggtttgatcgcctacagccgaaactaccggcagcggctttat
gcaaccaatgttaccggaaccggcaatctggtcaatgcctgtctggctgagggtgtcaca
cggctggtccacaccagttcagtcgcggcggcaggggttggcgatgatggtgagccggcc
gatgaaacaacgccgttcagggagtggcagcacaggattgcatatatggagtcgaaacat
cttgccgagatggaagggcggagaggtattgcagaagggctggatgtggtgtttgtcaat
cccggcgtcgtgatcggcactccttccaacccggcaggacgtttgaactcctcttccagg
gcgattcgtgatatctatcgtggtacaattcctgtgtatccttcaggaggcatcagcctg
gtcgatatcggcgatgttgccgatgcccaccttgccgcatggcggcatggccggagcgga
cagcgctatctggtgactgcagggaattattcgttccgccagttgtttgccatgatcgcc
gcaatgccgggaagcgctgccggaaaggcttatcaggcggcatctgtcgtggagtcggtc
gttggtgtggcgggtgagttgtttgctctcctgacaggctccaggccctatctcagcgtc
gaaagtatgaggcttgcacgaacgttactgtattacagcaaccgtctgtctgtcgaagaa
cttggcatgcaatatcgcccggttgaagagacacttcgctcgattgtttctcaagcggca
gtataa

DBGET integrated database retrieval system