KEGG   Prosthecochloris aestuarii: Paes_1974Help
Entry
Paes_1974         CDS       T00732                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
paa  Prosthecochloris aestuarii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Paes_1974
Enzymes [BR:paa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Paes_1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2162974..2166807
Genome map
AA seq 1277 aa AA seqDB search
MRFLFLTMEATNNCALKAAAASLRKDFAIDLEVSIINIGLHNKQETWLELEKGIASADFI
FGSMLFSEEIVRPLEELLDTADCPVCMITSNPALISKTKIGRFSLKKLQREEEEKNIFMQ
WAKKLRPAKQHGETQRQLALVRNVSKLMKHIPGKARDIHTFIAAHQFWLNGSEENMRRFL
SLLIDRYIPGEKGKLPQEDPLFYPDTAICHPDAPEPLYTVKAYQEWKSRRKKKGKEGSVM
MLVMRATVLGRNMQHIDYLCRSLEAQGLDVSIVYCSGLDFRPALNAFVGKDSPSKLSPDL
LLNTTGFSLVGGPAENKSKEAVEALKQLDIPYMNLVPLSFQTIAQWQSNAVGLTPLQTAL
CVAVTELDGAIEPHVYAGTSETSDRTIPLTREIQSITARILQQVRLGKKEPSEKKIAIVL
FNFPPNLGNAGTAAYLDVFDSLLRLLEALRDAGYRVDMPAGRDEMKTKILDGNRDIYGTD
GHVCAHLPVETYRSIAPHYHEIEAFWGDAPGEILNDGTSFHILGFTFGNIFVGQQPSFGY
ERDPMRLLMAKDAAPNHAFAAFYAWIEQIYHADAVIHFGTHGALEFMPGKQTGLSASCWP
KRLIGSLPNFYYYSVNNPSEGAIAKRRGFATLISYLTPPLEHAGLYKGLRTLRDLIESWY
SNPADDLLEEIDTLAATLELTPRSPEVTVEASLARLNHELYEVEERMIPLGLHKIGSSPQ
PEALVDQLALLGCHPRAELENRSLPEYICHLQHIDYDELNRQRSTSHSAADKWQELISIT
REALRQFIGTIPPQESAATPLRTMLEASYPIRRSNAERYLHQKAGVKASTMTRFWDFMQR
VLLGCTENREIQAMLEALDGRYIEPSPGNDLVRNPDIVPTGRNIHSLDPFSIPSSHAQKR
GKLSAEALLAEYRAENGALPESIAIVLWGTDNLKSDGEGVAQALALVGAATVTDELGKVS
NVRLIPPEELQRPRIDIVVTVSGIFRDLLSHQIRLLDKAVRLAAMADEPDSLNFIRKHVL
QESQEKNLSMEQAANRIFSNAPGSYGANVNHLIENSGWQQEQELAETFINRKSFAVNAEG
TWEECPEVLTSALRHVSLTFQNIDSYEIGISDIDHYYEYLGGISKTVELISKKKPSIMVG
DINGYGEQQKICSLEKMVSLESRTKLLNPKWYESMLEHGYEGVREIESHLSNTYGWSATA
SAVKDWTYQQFNETYLQDPEMLERLKSLNLHATMSMTRRLLEANSRGFWNTDSRTIDELQ
ELYADLETRMEGAGDEP
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttctctttttgaccatggaggcaacaaacaattgcgccctcaaagccgcagct
gcctcgctgagaaaggattttgccatcgatctggaagtctcgattatcaatatcggactt
cataacaaacaggaaacctggctcgaactcgaaaaaggtatcgccagtgccgatttcatt
ttcggttcgatgctcttcagcgaagagattgtccgcccccttgaagaactcctcgataca
gcagattgccctgtctgtatgatcacgagcaaccctgcactgatttcaaagacgaagatc
ggacgcttctcgctcaagaagctgcagcgtgaggaggaggaaaaaaacatcttcatgcag
tgggcaaaaaaactccggcccgccaaacagcacggggaaacccaacggcagctggccctg
gtccgcaatgtgagcaaactcatgaagcatattcccggaaaggcacgcgatatccacacc
tttattgcagcccaccagttctggctgaacgggtctgaagaaaacatgaggcgctttctc
tcgctgcttatcgaccgctatatccccggagaaaaaggaaaacttccgcaagaggacccg
ctcttctatcccgatacagcgatctgtcatcccgatgcgcctgaaccattgtatacggtc
aaagcatatcaggaatggaaaagccgccgcaaaaaaaagggaaaagaaggctccgtcatg
atgctcgtcatgcgagcgaccgtgcttggcagaaacatgcagcatatcgattatctctgc
cgttcacttgaagcgcagggactcgatgtctctatcgtctactgcagcggcctcgacttc
agacccgccctgaatgcttttgtcgggaaggactctccatcaaaactctcacccgacctt
cttctgaacacaaccggattttcactggtgggcggtccggcggaaaataaatcaaaagag
gctgtcgaggcgctgaaacaactcgatatcccctacatgaatctggtcccgctttcattt
cagaccattgcccagtggcagtcgaacgcggtagggctcaccccccttcagacagcgctc
tgtgtcgccgttacagagctcgacggggcaattgagccgcatgtctatgccgggacatct
gaaaccagcgacagaacaattccgctcacccgtgaaattcagagcatcaccgcaagaatc
ctgcagcaggtccgactcggaaaaaaggagccgtcagagaaaaaaatcgccattgtcctg
ttcaattttcccccgaatctcggcaacgccggtacggcggcatatcttgacgtctttgac
agtctcttgaggcttcttgaagcgctccgcgatgcaggctatcgggtcgatatgccagca
ggcagggatgagatgaaaacaaaaatccttgacggcaatcgcgacatctacggaacagac
ggccatgtctgcgcgcacctcccggtagaaacctaccgatcgatcgcgcctcattatcat
gaaatagaggcgttctggggagacgcaccgggagagatcctgaacgatggaacatcattc
cacattctcggcttcacattcggcaatattttcgtcggtcagcagccgtcgttcggctat
gagcgcgaccccatgcgccttctgatggcaaaagatgctgcaccgaaccacgcctttgca
gcattctacgcatggattgaacagatctaccatgccgatgccgtcatccacttcgggacc
cacggagcgctcgagttcatgccgggcaaacagaccgggctcagcgcctcctgctggccg
aaacgccttatcggatcattaccgaacttttattactactcggtcaacaatccgagtgaa
ggcgctatcgctaaaagaagaggctttgcaacgcttatcagctatcttactcccccgctc
gagcatgccggcctgtacaaaggcctcagaacactgcgcgacctgatcgaaagctggtac
agcaatcccgcagacgatctgctcgaagagatcgacaccctcgccgcaacactggaactg
acgccacggtcgcctgaggtgacggttgaagcatcgctcgcccgcctcaatcatgagctc
tatgaggttgaagaaaggatgatccctctcggcctgcacaaaataggcagcagtccgcaa
ccagaagcgctggtcgatcagcttgcgcttctcggctgccacccccgagcggaactcgag
aaccggtcgcttcctgaatacatctgccacctgcagcatatcgattacgatgaactcaac
cgccagcgaagcaccagtcatagcgctgccgacaaatggcaggagctcatatcgatcacc
cgtgaagcactcagacagttcatcggaaccataccaccgcaagagagtgcagcaacgccc
ttacgcaccatgctggaagccagctatccgatacgccgttccaacgctgaacgctatctg
catcaaaaagccggagtgaaagcatcgacaatgacccgcttctgggacttcatgcagcga
gtgctcctcggctgtacagaaaaccgcgaaattcaagccatgctcgaggcgcttgacggg
cgctacatcgagccctcccccggtaacgatctggtccgcaatcccgatattgtcccgaca
gggcgcaatattcatagcctcgacccattcagcataccctcctcccatgcacagaaacgg
ggcaaactgagcgcagaagccctgcttgcagagtaccgcgccgaaaacggcgcactgccg
gaatccatcgctatcgtcctgtggggaaccgacaacctgaaaagtgacggagagggcgtc
gcccaggcactggcgctcgtcggagcagcaacagtcactgacgaactcggcaaagtcagt
aacgtccgcctcatccctcccgaagagctgcagcggccccgtatagatattgtcgtcacc
gtcagcggcattttccgcgacctgctgtcgcaccagatccggttactcgacaaagctgtt
cgccttgctgccatggcagatgagcccgattcgctcaatttcatccggaaacatgtgctg
caagagtctcaggaaaagaacctgagcatggaacaggctgcaaaccgcattttttccaat
gctccaggcagctatggagcaaatgtcaatcaccttatcgaaaacagcggctggcaacag
gagcaggaactggctgaaacattcatcaacaggaaaagttttgccgtcaatgccgaagga
acatgggaagaatgccctgaagtattaacttccgccttgcgtcatgtctccctgacgttt
cagaatattgacagttatgaaatcggtatttccgatattgatcattattatgagtatctt
ggtggcatttcaaaaaccgtggaactgatcagcaaaaagaaaccgagcatcatggtcggc
gatatcaacgggtatggagagcagcagaagatctgctcccttgagaaaatggtctctctc
gaatcgaggactaaactgctcaacccgaaatggtatgaatccatgcttgagcacggctat
gaaggggtccgcgaaattgaatcgcatctcagcaacacctacggatggagcgcgacggcc
tctgccgtcaaggactggacctatcagcagttcaacgaaacctatctgcaggaccctgag
atgcttgaacgcttgaaaagcctgaacctgcacgcaacaatgtcgatgacccgacgcctg
ctcgaagccaattcgagaggcttctggaacacagacagcaggactatcgatgaactccag
gagctctatgcggaccttgaaacacgcatggaaggcgccggagacgaaccctaa

DBGET integrated database retrieval system