KEGG   Prosthecochloris aestuarii: Paes_2015Help
Entry
Paes_2015         CDS       T00732                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
paa  Prosthecochloris aestuarii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_2015
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_2015
   00052 Galactose metabolism
    Paes_2015
   00500 Starch and sucrose metabolism
    Paes_2015
   00520 Amino sugar and nucleotide sugar metabolism
    Paes_2015
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Paes_2015
   00524 Butirosin and neomycin biosynthesis
    Paes_2015
Enzymes [BR:paa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Paes_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2211420..2212412)
Genome map
AA seq 330 aa AA seqDB search
MRMAWAIGIDLGGTAVKIALIDRHTGIADHERHATRLDAGPEGVIEQIAALACASYHRGV
DRFGPDSFAGIGLGAPGGVDSTRGILSYPPNLPGWTRYPLRDALRKALEQEILSLPALMV
DNDANAAALGEAYFGAGQTFSDFMLVTLGTGVGGGIILNRALYRGSHGTAGEIGFMTIDY
RGQSVHAGVRGTLEGLIGKEKIVTLAKERYREHPRKLWSPQHHGEDLSLLSPRTLEHAAH
SGDAIAMSIWREVGSILGVGLAGVVALLDIRKFVIGGGISAAGDLVIVPALDRIRHSTLP
SMHDDLEVIRASLGNDAGVYGAAALCFESP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatggcgtgggcgataggtatagatcttggcggtactgcggtaaaaattgcgctc
attgatcgtcataccggtattgcagaccacgagcgtcatgcaaccagactcgatgccggc
cctgaaggcgttattgagcagattgccgctcttgcctgtgcaagctatcacagaggtgtt
gatcggtttggcccggatagttttgccggcatagggcttggtgctccgggaggcgttgac
agcactcgcggtatcctctcctatcctccgaatcttcccggctggacccgctatcctctg
cgcgatgcgctccgcaaagccctggaacaggagatcttgagtctgcccgcgctcatggtt
gacaacgatgccaacgcggcagcattaggagaggcatattttggtgccggtcaaaccttc
agcgattttatgctggtgacgcttggtacgggtgttggtggcggcattattctcaatcgg
gcgctctatcgcggttctcacggaacggcaggtgaaatcggttttatgacaatcgattat
cggggccaaagtgttcatgccggggtcagggggacgcttgaaggtcttataggcaaagaa
aaaattgttacgcttgccaaagagcgctaccgtgagcatccccggaagctgtggtctcca
caacatcacggggaggatctctccctgctttccccaaggacgcttgagcatgctgcccat
tcaggagacgcgattgccatgtcgatatggcgggaagtcggttcaattcttggtgtgggc
cttgccggtgttgttgcgcttctcgatatccggaagtttgtgattggcggtggtatttct
gccgccggggacctggttattgtaccggctctcgatcggatacgccactccacgctgccg
tcgatgcatgatgaccttgaagtgatcagagcgtcattagggaacgatgccggagtctat
ggagccgcggcactctgtttcgagagtccataa

DBGET integrated database retrieval system