KEGG   Prosthecochloris aestuarii: Paes_2172Help
Entry
Paes_2172         CDS       T00732                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
paa  Prosthecochloris aestuarii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Paes_2172
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Paes_2172
Enzymes [BR:paa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Paes_2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2345733..2346860
Genome map
AA seq 375 aa AA seqDB search
MKKKALLSLLVLLITNILSACASNQQAEDGIDAKIGRMIMVGFRGMSIEEAPWISDDIAS
KRIGGVILFDYDVPSASTTRNIASPGQLAALTRQLQECSPEPLLIAIDQEGGRVSRLKPS
RGFPESVSAAHLGAVNDPDSTLRSAATTAATLQSMHINLNFAPVADVNINPDNPVIGRLE
RSFSSDPAIVALHAAATVQAMHEAGIHTALKHFPGHGSSTTDTHKDFTDVTTTWTPKELD
PYRALIKEGYRDFIMTAHVFNAQLDPDYPATLSQKTITGMLRDSLGFRGAVISDDMQMQA
IAAHYGLETAIRLALDAGVDILLFANNSTYDPDIGRKTFTIIKTLVDNGTISRKRIEESW
ERINTMQHNLLPAEQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaagcactcctctcactcctcgttctgcttatcacaaacatactctccgcc
tgcgcttccaatcagcaggcagaggatggtatcgatgcaaaaatcggcaggatgatcatg
gtcggattccgcggaatgtcgattgaagaggctccgtggatcagcgacgatatcgccagc
aagagaatcgggggagtgatcctcttcgattacgacgttccttcggcatcgacgacgaga
aacatcgcatcgcccggccagcttgccgcattgacccgtcaactccaggagtgttccccc
gaaccgcttctgatcgccatcgatcaggaaggcggcagagtttcacgactgaaaccctcc
cggggatttcccgaaagcgtttcagcggcgcatcttggcgccgtcaacgatcccgacagc
accttgcggagcgcagcaacaactgcggcaacgctgcaatcgatgcacatcaacctgaac
ttcgccccggtagctgatgtcaatatcaatccggacaaccccgtcataggccgtctggaa
cgaagcttctcgtccgaccctgcaatcgtcgcattgcatgcggcagcaacagtacaggcc
atgcacgaagcagggatccatactgcgctgaaacacttccccggccacggcagttcaaca
accgatacccataaggatttcaccgacgtcaccaccacctggacgccgaaagaactcgat
ccctacagggcactcatcaaagaaggataccgcgatttcatcatgactgcgcatgtattc
aacgctcagctcgaccctgattatccggcaacactgtcacagaaaaccatcaccggcatg
cttcgcgactcgctcggcttcaggggcgctgtcatcagtgacgacatgcagatgcaggct
atagccgcccattacgggctcgaaacagctatcaggctggctctcgatgctggagttgat
attctgctcttcgccaacaattcgacctacgaccccgatattgggaggaaaacatttaca
atcatcaaaacactcgtcgataacggcaccatcagcaggaaacggatcgaagaatcgtgg
gagcggatcaataccatgcaacacaaccttttaccggcagaacaatga

DBGET integrated database retrieval system