KEGG   Prosthecochloris aestuarii: Paes_2227Help
Entry
Paes_2227         CDS       T00732                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
paa  Prosthecochloris aestuarii
Brite
Enzymes [BR:paa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Paes_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2407550..2408296)
Genome map
AA seq 248 aa AA seqDB search
MQTASVGVLIIHGFTATLESVMGLVDPLREMGVRVSVPVLRGHGADSPEMLRGVTWQDWM
KDAETAFLELSQSVDRVFVVGHSMGGLIALNLAAKYRERIDGVVVAAPAIRLVSMLAPDR
PLHFLTPILQSVVRNWDLKVAFSDPDEDGARVHYSWAPTDAIRSFFDLISFTHSRLHDIS
CPVLILHNRAEKTVLPESASIVYDNIATPEEDKELVWLERSEHQMFCDCEKERAIAIIVD
YIRRKIAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcagactgcttctgtcggagtattgatcattcacgggtttaccgccacgctggaaagc
gtgatgggtctcgtcgatccattacgtgaaatgggggtcagggtcagtgttcccgttctc
cgggggcatggcgctgattcaccggaaatgctcagaggcgtgacatggcaggattggatg
aaggatgccgaaactgcctttctcgaactatcgcaatcggttgacagggtatttgtcgtt
ggtcacagtatgggcgggttgatcgcgttgaatctcgcggcaaaatatcgtgagcgaatt
gatggcgttgtcgtagctgctccggctattcggctggtttcgatgcttgctccggatcgt
cctcttcattttcttaccccgatccttcagtcggtagtcagaaactgggaccttaaggtt
gccttcagtgacccggacgaagatggcgcgcgagtccactactcgtgggcccctaccgat
gctattcgttcttttttcgacctcatatcctttacccattccagactgcacgatatttcc
tgccccgtgctcattctgcataaccgtgcggagaaaaccgtgttgcctgaaagtgcctcg
atcgtctacgacaacattgccacgcctgaggaagacaaggagcttgtctggcttgaacgg
tcggagcatcagatgttctgtgattgtgaaaaagagcgagcgatcgctatcattgttgac
tatatcaggcggaagatcgcggcatga

DBGET integrated database retrieval system