KEGG   Prosthecochloris aestuarii: Paes_2256Help
Entry
Paes_2256         CDS       T00732                                 

Definition
succinate dehydrogenase, membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
paa  Prosthecochloris aestuarii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Paes_2256
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Paes_2256
   00650 Butanoate metabolism
    Paes_2256
  Energy metabolism
   00190 Oxidative phosphorylation
    Paes_2256
   00720 Carbon fixation pathways in prokaryotes
    Paes_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2433933..2434430)
Genome map
AA seq 165 aa AA seqDB search
MNQSLHETPPVTISSKIEAFGWVMQRFTGLGLVLFLALHFWVQHMPNGYLATATEYNDIV
AEFATKSPEYAEAIADGHIKEALPEEHVITYSSVAARLANPLWKAIDIMLLLFALAHGLN
GLNNVLVDYVQRAALRKALFAGSLAVCLFLSVQGIASILAAGSGA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtcacttcatgagacaccgccggtaactatttcttcaaagatcgaggcgttt
ggctgggtgatgcagcgctttacaggtcttggtctggtgctctttcttgccctgcatttc
tgggtgcagcatatgccgaatggatatcttgcgacagcgaccgagtacaacgatatcgtg
gctgaatttgcgacaaagagtcctgaatatgctgaagctattgcggacggccatatcaaa
gaggctcttcctgaagagcatgtcattacctacagcagcgttgccgcaaggttagccaac
ccgttgtggaaggcgattgatattatgctgctgctttttgctcttgctcatggtctcaac
gggttgaacaatgttcttgtcgattatgttcaacgggcagcgcttcgtaaggccctgttt
gcaggaagtcttgccgtctgtcttttcctctctgttcagggaattgcctctattcttgct
gccgggtctggcgcgtaa

DBGET integrated database retrieval system