KEGG   Prosthecochloris aestuarii: Paes_2256Help
Entry
Paes_2256         CDS       T00732                                 

Definition
(GenBank) succinate dehydrogenase, membrane subunit, putative
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00020  Citrate cycle (TCA cycle)
paa00190  Oxidative phosphorylation
paa00650  Butanoate metabolism
paa00720  Carbon fixation pathways in prokaryotes
paa01100  Metabolic pathways
paa01110  Biosynthesis of secondary metabolites
paa01120  Microbial metabolism in diverse environments
paa01130  Biosynthesis of antibiotics
paa01200  Carbon metabolism
Module
paa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Paes_2256
   00650 Butanoate metabolism
    Paes_2256
  Energy metabolism
   00190 Oxidative phosphorylation
    Paes_2256
   00720 Carbon fixation pathways in prokaryotes
    Paes_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACF47257
JGI: Paes2256
UniProt: B4S6F5
Position
complement(2433933..2434430)
Genome map
AA seq 165 aa AA seqDB search
MNQSLHETPPVTISSKIEAFGWVMQRFTGLGLVLFLALHFWVQHMPNGYLATATEYNDIV
AEFATKSPEYAEAIADGHIKEALPEEHVITYSSVAARLANPLWKAIDIMLLLFALAHGLN
GLNNVLVDYVQRAALRKALFAGSLAVCLFLSVQGIASILAAGSGA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtcacttcatgagacaccgccggtaactatttcttcaaagatcgaggcgttt
ggctgggtgatgcagcgctttacaggtcttggtctggtgctctttcttgccctgcatttc
tgggtgcagcatatgccgaatggatatcttgcgacagcgaccgagtacaacgatatcgtg
gctgaatttgcgacaaagagtcctgaatatgctgaagctattgcggacggccatatcaaa
gaggctcttcctgaagagcatgtcattacctacagcagcgttgccgcaaggttagccaac
ccgttgtggaaggcgattgatattatgctgctgctttttgctcttgctcatggtctcaac
gggttgaacaatgttcttgtcgattatgttcaacgggcagcgcttcgtaaggccctgttt
gcaggaagtcttgccgtctgtcttttcctctctgttcagggaattgcctctattcttgct
gccgggtctggcgcgtaa

DBGET integrated database retrieval system