KEGG   Pyrococcus abyssi: PAB0050Help
Entry
PAB0050           CDS       T00024                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pab  Pyrococcus abyssi
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PAB0050 (speB)
Enzymes [BR:pab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PAB0050 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79959..80810
Genome map
AA seq 283 aa AA seqDB search
MLLYTYRSFDMELPTVSIEEADYVIMGLPFDGTTSYKPGARFGPVLIRQATLNLESYILD
YDVDIAELKIADAGDVALPVNVEDAIKVGIEAIKELRSVNRKALPIFLGGEHSMTYPPVA
VLKPKSYVVFDAHLDLRDSYQGSRFNHACVARRIHENGVEVAIFGVRSGTREEVKYATEN
GIEWVHARDYNFDAFVDLVASLSEPIYVSIDIDVFDIPLVPETGTPEPGGLRFWDVVNAL
EWLTERKNVVGFDIMEVSGDKLGNVTSITAAKLLFHILGMSSR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgctactgtacacttatcgctcgttcgacatggagctgccaactgttagcatagaggag
gctgattacgttataatgggactgcccttcgatggcaccacgagctataagccaggagct
aggtttggaccggttttaataaggcaggctactttaaaccttgaaagttacatcctcgac
tacgacgtggatatagctgagctaaagatagcagacgctggagatgtagcattaccggta
aacgttgaggatgcaataaaggtgggcattgaagccataaaggagctaagatcggtgaat
cggaaggccctacccatattcctcggaggagaacactcaatgacgtacccgccagtagcg
gttcttaaaccgaaaagctacgtcgtcttcgatgcacaccttgacttaagggactcctac
caaggatcaaggttcaatcatgcttgcgttgctagaagaatacacgaaaatggcgttgaa
gttgctatctttggcgttaggagtggaaccagggaagaagtaaagtacgctacggaaaac
ggcattgaatgggttcatgcaagggattataatttcgacgcattcgttgatctagttgcc
agtctatcagagccaatctacgtctcaattgacatagacgtttttgatatccccctcgtc
ccagaaactggaacacctgagcctggaggattaagattttgggatgtggtgaatgcgttg
gagtggcttacggagagaaagaatgtcgttggattcgatataatggaagtttcgggagat
aaactgggtaacgttacttcaataaccgctgcaaagcttctatttcacatcttaggaatg
agctcaaggtga

DBGET integrated database retrieval system