KEGG   Pyrococcus abyssi: PAB0203Help
Entry
PAB0203           CDS       T00024                                 

Gene name
sucC-like
Definition
succinyl-coa synthetase, beta subunit related protein
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
pab  Pyrococcus abyssi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pab00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pab00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pab00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
310853..311551
Genome map
AA seq 232 aa AA seqDB search
MDRIAKAREIIEKAKAENRPLVEPEAKEILKLYGIPIPEFKVARDEEEAVKFSREIGYPV
VMKIVSPQIIHKSDAGGVKINIKNDEEAREAFRTIMENARRYKPDADLWGVIIYRMLPLG
KEVIVGMIRDPQFGPAVMFGLGGIFVEILKDVSFRVAPISKEDALEMIKEIKAYPILAGA
RGEKPVNIDALADIIVKVGELALELPEIRELDINPIFAYEDEAVAVDARMLL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggacagaatagcaaaagcaagggagattattgagaaggcaaaggctgaaaataggcca
ctcgttgagcccgaggctaaggagatcctcaagctctatgggattccaatacctgagttt
aaagtcgcaagagatgaggaggaagctgtgaagttctcaagggaaataggttatccagtt
gtcatgaagatagtttcgcctcagataatccacaagagcgatgctggtggagttaagata
aacatcaagaacgatgaagaggcaagggaagcctttagaactataatggagaacgccaga
aggtacaagcctgatgcagatctttggggagttataatctacaggatgctacccctagga
aaggaagttatagttggtatgataagggatccacagttcgggcccgcggtaatgttcgga
cttggtggaatattcgttgagattctcaaggacgtcagcttcagggttgctccaataagc
aaggaagatgcccttgaaatgataaaggagataaaggcgtacccaatattggctggagct
agaggggagaagcctgtgaacattgatgcattggctgatataatagttaaggtaggagag
cttgccttagagcttcctgagataagggagctagatatcaatccaatattcgcatacgag
gatgaagccgttgcagttgatgctagaatgcttctctga

DBGET integrated database retrieval system