KEGG   Pyrococcus abyssi: PAB0369Help
Entry
PAB0369           CDS       T00024                                 

Gene name
thrC-like
Definition
(GenBank) thrC-like probable threonine synthase (EC 4.2.3.1)
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pab  Pyrococcus abyssi
Pathway
pab00260  Glycine, serine and threonine metabolism
pab00750  Vitamin B6 metabolism
pab01100  Metabolic pathways
pab01110  Biosynthesis of secondary metabolites
pab01120  Microbial metabolism in diverse environments
pab01230  Biosynthesis of amino acids
Module
pab_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAB0369 (thrC-like)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAB0369 (thrC-like)
Enzymes [BR:pab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAB0369 (thrC-like)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Acyl_transf_2
Motif
Other DBs
NCBI-ProteinID: CAB49460
UniProt: Q9V190
Position
509908..510939
Genome map
AA seq 343 aa AA seqDB search
MLVCTKCGRTFDEKFLLRCTCGGTLLVKRHYTSFSPRNYLDMRRYIDYLPVDSVFLPKLT
PAITPIVKDSEDLYLKLDYLQPTGSFKDRGTYVTIAKLKEEGINEVVIDSSGNAGISLAA
YGLSEGIKVHVFLSYDANKEKISRLSALNAKLHFVDGDRMKVHEEAIRFSRDGNLTYVSH
WMNPYFLEGTKTIAFEIYEQIKLPDYVFIPVGSGTAFLGIWKGFKELIEMGEIESMPSLV
AVQAEGFESLCKRSKRKNTLADGIAIPEPPRIEEMKQAIKESSGFCISVGKEETLASLHW
LRKRGILVEGTSAVTLAAYWKAKELELIDGVSLLILTGSAKNF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctggtctgcactaaatgtggaagaacttttgatgagaaatttctgctaaggtgtact
tgcggagggacattgctcgttaagaggcactacacaagcttctctcccaggaattactta
gacatgagacggtacatcgattatcttccagtggattcagttttccttccaaagttgacc
ccggcaataacccccatagttaaggactccgaagatttatacctaaaactcgattacctc
cagcccacgggatcttttaaggataggggaacctacgtgacgattgcaaagcttaaagag
gaggggattaatgaagttgtcatagatagctctggaaatgccggtataagcttagcagct
tatggtctctccgaggggataaaggttcacgtttttctctcctacgatgcaaataaggaa
aagatatcgcgattaagcgctttgaacgccaagctacatttcgtcgatggggataggatg
aaagttcatgaagaggcgataaggttctcgagagatgggaatttaacttacgtttcgcac
tggatgaatccctatttcttggaaggaactaaaacgatagcctttgagatatatgagcag
ataaagctccctgactatgtattcattccagttggtagtgggacggcattcctggggata
tggaagggttttaaggaattaattgaaatgggggaaattgagtcgatgccttcacttgta
gcggttcaggcagaggggtttgagagcctctgcaaaaggtctaaaaggaaaaacacattg
gccgatgggatagcaattcccgaacccccgaggatagaggagatgaagcaagctattaaa
gagagctcaggtttttgcataagcgttggaaaggaagaaaccctagcttcccttcattgg
ttgaggaaaaggggtattttagttgaaggaacttcggccgtcactctagcggcgtactgg
aaggctaaggaactagaactaatagatggggtttccctcttgatactaactggttcggct
aagaatttttag

DBGET integrated database retrieval system