KEGG   Pyrococcus abyssi: PAB0437Help
Entry
PAB0437           CDS       T00024                                 

Definition
(GenBank) endO 1,4-betaglucanase (cellulase M) (EGM)
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
pab  Pyrococcus abyssi
Brite
Enzymes [BR:pab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     PAB0437
Peptidases [BR:pab01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   PAB0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
600398..601444
Genome map
AA seq 348 aa AA seqDB search
MVNYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEVKVDKLGNVIAHRKGEGPKVMI
AAHMDQIGLMVTNIEKNGFLRVAPIGGVDPKTLIAQRFKVWIDKDKFIYGVGASVPPHIQ
KPEERKKAPEWDQIFIDIGAESKEEAEEMGVRIGTVITWDGRLERLGKHRFVSIAFDDRI
AVYTMLEVARQLEDTKADVYFVATVQEEVGLRGARTSAFAIEPDYGFAIDVTIAADVPGT
PEHKQVTHLGKGTAIKIMDRSVICHPTIVRWLEELAKKYEIPYQLEILLGGGTDAGAIHL
TKAGVPTGALSVPARYIHSNAEVVDERDVDATVKLMVKALENIHELKI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtgaactacgagcttctgaagaaggttgtagaggccccaggagtttctggatacgag
ttcctgggaataagggacgttgtcatagaggagataaaggattacgtggacgaggtaaag
gtggacaagttaggaaacgtcatagcccacaggaagggagaagggccgaaggtcatgata
gccgcgcacatggatcagataggtttaatggtaactaacatagagaagaatggcttcttg
agggtcgctcccattggaggtgttgacccaaaaacgctgatagctcagaggtttaaggtg
tggatcgacaaggataagttcatctatggtgttggagcttcagttcctccacacatccag
aagccagaggagaggaagaaggctcctgagtgggaccagatattcatagacataggggcc
gagagcaaagaggaagcagaagagatgggagttagaataggaaccgtaataacctgggac
ggtaggcttgagaggctaggaaagcacaggttcgtgagcatagccttcgatgacaggatt
gcagtgtacacgatgcttgaagttgccaggcagttggaagatactaaagctgatgtttac
tttgtggcaacggttcaagaggaggtaggtcttaggggcgctagaacttcagcatttgca
attgagcctgattacggatttgcgatagatgtaaccatagccgcagacgttccaggaacg
cctgagcacaagcaggtgacccacttaggaaagggaaccgcaataaagataatggatcgc
tcagtaatatgccacccaactatagtgagatggctcgaagagttggctaagaagtacgag
attccatatcagcttgagatcctcctgggcggagggacagatgcgggagcaatacactta
acgaaggcaggagtgccaaccggtgctttaagcgttccagcgaggtacatccactcgaat
gctgaagttgtcgatgagagggacgttgatgccacggttaagttgatggtcaaggccctc
gagaacatccacgagctcaagatctga

DBGET integrated database retrieval system