KEGG   Pyrococcus abyssi: PAB0437Help
Entry
PAB0437           CDS       T00024                                 

Definition
aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pab  Pyrococcus abyssi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pab00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
600398..601444
Genome map
AA seq 348 aa AA seqDB search
MVNYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEVKVDKLGNVIAHRKGEGPKVMI
AAHMDQIGLMVTNIEKNGFLRVAPIGGVDPKTLIAQRFKVWIDKDKFIYGVGASVPPHIQ
KPEERKKAPEWDQIFIDIGAESKEEAEEMGVRIGTVITWDGRLERLGKHRFVSIAFDDRI
AVYTMLEVARQLEDTKADVYFVATVQEEVGLRGARTSAFAIEPDYGFAIDVTIAADVPGT
PEHKQVTHLGKGTAIKIMDRSVICHPTIVRWLEELAKKYEIPYQLEILLGGGTDAGAIHL
TKAGVPTGALSVPARYIHSNAEVVDERDVDATVKLMVKALENIHELKI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtgaactacgagcttctgaagaaggttgtagaggccccaggagtttctggatacgag
ttcctgggaataagggacgttgtcatagaggagataaaggattacgtggacgaggtaaag
gtggacaagttaggaaacgtcatagcccacaggaagggagaagggccgaaggtcatgata
gccgcgcacatggatcagataggtttaatggtaactaacatagagaagaatggcttcttg
agggtcgctcccattggaggtgttgacccaaaaacgctgatagctcagaggtttaaggtg
tggatcgacaaggataagttcatctatggtgttggagcttcagttcctccacacatccag
aagccagaggagaggaagaaggctcctgagtgggaccagatattcatagacataggggcc
gagagcaaagaggaagcagaagagatgggagttagaataggaaccgtaataacctgggac
ggtaggcttgagaggctaggaaagcacaggttcgtgagcatagccttcgatgacaggatt
gcagtgtacacgatgcttgaagttgccaggcagttggaagatactaaagctgatgtttac
tttgtggcaacggttcaagaggaggtaggtcttaggggcgctagaacttcagcatttgca
attgagcctgattacggatttgcgatagatgtaaccatagccgcagacgttccaggaacg
cctgagcacaagcaggtgacccacttaggaaagggaaccgcaataaagataatggatcgc
tcagtaatatgccacccaactatagtgagatggctcgaagagttggctaagaagtacgag
attccatatcagcttgagatcctcctgggcggagggacagatgcgggagcaatacactta
acgaaggcaggagtgccaaccggtgctttaagcgttccagcgaggtacatccactcgaat
gctgaagttgtcgatgagagggacgttgatgccacggttaagttgatggtcaaggccctc
gagaacatccacgagctcaagatctga

DBGET integrated database retrieval system