KEGG   Pyrococcus abyssi: PAB0647Help
Entry
PAB0647           CDS       T00024                                 

Gene name
aor-2
Definition
tungsten-containing aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pab  Pyrococcus abyssi
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAB0647 (aor-2)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAB0647 (aor-2)
Enzymes [BR:pab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PAB0647 (aor-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925189..927012
Genome map
AA seq 607 aa AA seqDB search
MFGYWGKILRVNLTDGTIKEETFNEEFAKKWLGTRGFGIYFLLKEMDPKVDPFSPENKLI
FATGPLTGTSAPTGGRYMVITKSPLTGYIAMANSGGYFGAELKFAGWDAIIIEGKADHPV
YLYIHDENVEIRDASKVWGKLVSETEKALKEEVGDKHVQIASIGPAGENKVRFAAVMNNG
HRAAGRGGVGAVMGSKNLKAIVVRGHKRVEVADKGKFMEVIREKIEKLKKDPVAGGGLPK
YGTAVLVNIINEHGLYPTRNFQTGVFEYAYEQSGEAMAAKYLIRNKPCFACPIGCGRVNY
LPSIGETEGPEYESTWALGANLGINDLASIIEANHFADEYGMDTISLGGTLATAMELYER
GLIKQEDIGGENEPPFRFGNTEVLHYWIHKIAKREGFGDILAEGGYRLAERFNGTEYFMG
VKKQELPAYDPRGAEGHGLGYATNNRGGCHIKQYMISPEILGYPYKMDPHDISDEKVKMV
ILFQDLTALIDAAGLCLFTTFGLGADDYRDMLNAALGWDFSTEDYLKIGERIWNAERLFN
LKAGLDPLKEDTLPKRLLEEPMPEGPNKGHVVRLKEMLPRYYKLRGWTEDGRIPEEKLKE
LGLEEFI
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttactggggtaagatactgagggtaaacctaaccgatggaacaataaaggag
gaaacattcaacgaggaattcgccaagaagtggcttggaacgagaggatttggaatttat
ttcttgctgaaagagatggatccaaaggttgacccattctctccagagaacaagttgata
ttcgccacaggccccctaaccggaacttccgccccaacaggtggaaggtacatggtaatt
accaagagtccattaactggttacatagcgatggctaactcgggaggctacttcggtgcc
gagctaaagttcgccggttgggatgcgataataatcgaaggaaaagcagatcatccggtt
tacctctacatacacgatgagaacgtagagataagggatgcgagcaaagtttggggcaag
ctcgttagcgagaccgagaaggctcttaaggaggaagttggagataagcacgtccagata
gcctccataggcccagctggagagaataaggtcaggttcgctgccgtaatgaacaatggc
catagggctgccggtagaggtggagttggagctgtaatggggagcaagaacttgaaggcc
atagttgtcaggggacacaagagggttgaggtcgccgacaaaggaaagttcatggaggta
attagggagaagatagagaaactcaagaaagatccagtagcaggtggaggccttccaaag
tacggaactgccgttctcgtgaatataataaatgagcacggattgtatccaacgaggaac
ttccagactggagtttttgagtacgcctatgagcagagcggagaggctatggccgctaag
tacctaataaggaacaagccgtgctttgcgtgcccgataggatgtggtagggttaattac
ctgccgtcaataggagaaacagaggggcccgagtacgagagcacttgggcattaggtgct
aacctagggataaacgatttggcctcgataatagaagctaatcacttcgccgacgagtat
ggaatggataccataagccttggcggaacgttagctactgccatggagctctatgagagg
ggattgataaagcaagaagacataggtggagaaaatgagccgccattcaggttcggtaac
acagaggttctccattactggatacacaagatagcgaagagggaagggttcggagatata
cttgcggagggaggttaccgcttggctgagaggttcaacggaacggagtacttcatggga
gttaagaagcaggagttacctgcctacgatccgagaggtgctgagggacatggactcggt
tacgcaacgaacaacagaggaggatgtcacattaagcaatatatgataagcccagaaatc
ctgggttatccatacaagatggatccccatgacataagcgatgagaaagttaagatggtt
atcctgttccaggatctcactgcattaatagatgctgctgggctctgtctgttcacgacg
ttcggtcttggagcggatgactacagggacatgcttaacgccgctctaggttgggacttc
tcaacggaggactacctgaagataggagagagaatatggaacgctgaaaggttattcaac
ctcaaggctgggctagatcctctcaaggaagacacgttacccaagaggctcctcgaggag
ccgatgccagaaggacccaacaagggacacgtggttaggctcaaggagatgcttccaagg
tactacaagctcaggggttggacagaggacggaaggatcccagaggagaagcttaaggag
ctcggtctcgaagagtttatttag

DBGET integrated database retrieval system