KEGG   Pyrococcus abyssi: PAB0750Help
Entry
PAB0750           CDS       T00024                                 

Gene name
asnB
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pab  Pyrococcus abyssi
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pab00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1080728..1082167
Genome map
AA seq 479 aa AA seqDB search
MCLIAGGFNVSREDAIKIINLGKHRGPDSFGFWSERQMLKSDNFSDVSEIEGGEIALIQC
RLAMTGSKSYTQPFYNEIILVHNGEIYNHESLRKYLIERGVAFETDVDSEVILRLLEYLV
FDRKLKVEEAIKLSMKMLRGDYAVAFFFNGKFYLFRDPLGVRPLYYSSRGHFASEKKVLW
GLGEDAEPVLPGEIVSISKHGITRVRGFNVFSIRTQGKDYFNGLQNLLIDSVKVRASKKV
GVLFSGGVDSSLIALIASRYSDVILYTSGTEDSKDVEWARRVAEELGLKLRESLFSREDI
ENEIERIMFAIEEPNPMNLAIAIPLYFSTKRAREDGVKVLLSGQGADELFGGYAKYLQNP
GLMLKDVEELGERNLARDDKVAMLNGVETRYPYLDLPFAILALNVPLELKIRDGKRKFIL
REIAKSLGLPEWVAEREKKAAQYGSNAQKILEKIAKSRGVKLKGLADILFSKVFHGIQN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctaattgccggaggattcaacgtttcaagagaggatgcaattaaaataataaac
ctaggcaagcataggggacctgattcttttggattctggagcgaaaggcagatgttgaag
tcagataacttctcagatgttagtgaaattgaaggtggggaaattgctttaattcagtgc
agattagctatgaccggttcaaagagctatacgcaaccgttctacaatgagataattctc
gttcacaacggagaaatatacaatcatgagagccttagaaagtacctgatagagaggggg
gtagcatttgagaccgacgtcgatagcgaggttatattgaggctcttggagtacctcgta
tttgacaggaagttgaaagtagaggaagctattaagctctcaatgaaaatgctgagggga
gattacgcggtggctttcttctttaacggtaaattctacctttttagagacccccttgga
gttagacccctctactactcaagcagaggtcacttcgcttcagaaaagaaggtgctctgg
ggactcggagaggacgccgagccagtcctccctggggagatagttagtatctctaaacat
ggaataaccagggtaagaggattcaacgtcttttcaatcagaacccagggaaaggactac
tttaacggtcttcaaaacctcttaattgattcagtaaaggtcagggccagtaagaaggtt
ggggttctattttcaggaggggtggatagctcgttaatagccctcatagcctctcggtat
tccgatgttatcctctacacctccggaactgaggatagtaaggacgtcgagtgggcgagg
agggttgccgaggagcttggccttaagttgagggagagcctgttttcaagggaagacatt
gagaatgagatagagaggataatgttcgcaatagaagagccaaatccaatgaacctcgcc
atagcaatccccctgtacttctccaccaagagggccagggaagatggggttaaggtgttg
ctaagcggacaaggtgcagatgaacttttcggcggttatgcgaagtacctccaaaaccca
gggttgatgctcaaagacgttgaagagctgggagagaggaacttagccagagatgacaag
gtggcaatgttgaacggggtagagactaggtatccctacttggacttgccattcgcaatc
ctagcgttaaacgttcccctggaactcaagattagggatggaaagaggaaatttatactt
agggaaatcgccaagagcttagggttaccagaatgggtagcggaaagggaaaagaaagcc
gctcaatacggtagtaatgcccaaaagattctcgaaaagatagcaaagtctagaggggtt
aagctcaagggactcgccgatattctgttttccaaggtattccatggaattcaaaattag

DBGET integrated database retrieval system