KEGG   Pyrococcus abyssi: PAB0771Help
Entry
PAB0771           CDS       T00024                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPgp) (alpha-D-glucosyl-1-phosphate uridylyltransferase) (uridine diphosphoglucose pyrophosphorylase)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pab  Pyrococcus abyssi
Pathway
pab00040  Pentose and glucuronate interconversions
pab00052  Galactose metabolism
pab00500  Starch and sucrose metabolism
pab00520  Amino sugar and nucleotide sugar metabolism
pab01100  Metabolic pathways
pab01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAB0771
   00052 Galactose metabolism
    PAB0771
   00500 Starch and sucrose metabolism
    PAB0771
   00520 Amino sugar and nucleotide sugar metabolism
    PAB0771
Enzymes [BR:pab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAB0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD Smr
Motif
Other DBs
NCBI-ProteinID: CAB50070
UniProt: Q9UZI7
Position
1111966..1112841
Genome map
AA seq 291 aa AA seqDB search
MIRKAVIPAAGLGTRMLPITKSMPKEMLPIVDRPVIHYVVEEAVKAGIEDILIITGKGKR
AIEDYFDRSFELEYYLKERGKLEALREVEEIGEMVDIYYVRQKKPLGLGDAILYAEKHVN
GEPFAVLLGDDIIISKKPAIKQLIEVAERKNTPVIGVESVPRELVSRYGIIEGELIENDL
YRIKRLVEKPSPKEAPSNIAIIGRYILIPEIFDILRETPPGRDGEIQLTDALQILLNKNE
ILAKRIEGERYDIGSKFGFVMANLKLSLRREELRNEVLKYLKSILKEISNE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgattaggaaggcagtgattccagccgctggtttagggacgaggatgttgccgataaca
aaatctatgccgaaagaaatgctgcccatcgttgataggccggtgattcattacgtggtt
gaggaggcagtgaaggcgggtatagaggacattctgataattactggaaaggggaagagg
gcgattgaggattactttgacaggagctttgagctggagtactatttaaaagagaggggg
aaactggaggcgttaagggaagtggaagaaatcggagaaatggtggatatttactacgtg
aggcagaaaaaacccctcggtttaggcgatgcaattctttacgctgagaagcacgtgaac
ggagaaccattcgccgtactcctgggagacgacataataatcagcaaaaaaccagcaata
aaacaactaattgaggttgcagaaagaaaaaacactccagttatcggtgtggagagtgtt
ccaagggagcttgtgagtagatatggaatcatagagggcgagctaattgaaaatgatctg
tataggataaagcgtctcgttgagaagccttcccctaaagaagcaccaagcaatattgca
ataattgggaggtacattttaattcctgagatatttgatatcctgagggagaccccacct
ggaagagatggagagatacagcttacagacgccctccagatacttttgaacaagaatgaa
atccttgcaaaaagaattgaaggagaaagatatgacattggaagtaaattcggttttgtc
atggcaaatctaaaattgagcctcagaagagaagaattaagaaatgaagtattgaaatac
ctaaaaagtattttgaaggagatctcaaatgagtag

DBGET integrated database retrieval system