KEGG   Pyrococcus abyssi: PAB0771Help
Entry
PAB0771           CDS       T00024                                 

Definition
alpha-d-glucosyl-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pab  Pyrococcus abyssi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAB0771
   00052 Galactose metabolism
    PAB0771
   00500 Starch and sucrose metabolism
    PAB0771
   00520 Amino sugar and nucleotide sugar metabolism
    PAB0771
Enzymes [BR:pab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAB0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1111966..1112841
Genome map
AA seq 291 aa AA seqDB search
MIRKAVIPAAGLGTRMLPITKSMPKEMLPIVDRPVIHYVVEEAVKAGIEDILIITGKGKR
AIEDYFDRSFELEYYLKERGKLEALREVEEIGEMVDIYYVRQKKPLGLGDAILYAEKHVN
GEPFAVLLGDDIIISKKPAIKQLIEVAERKNTPVIGVESVPRELVSRYGIIEGELIENDL
YRIKRLVEKPSPKEAPSNIAIIGRYILIPEIFDILRETPPGRDGEIQLTDALQILLNKNE
ILAKRIEGERYDIGSKFGFVMANLKLSLRREELRNEVLKYLKSILKEISNE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgattaggaaggcagtgattccagccgctggtttagggacgaggatgttgccgataaca
aaatctatgccgaaagaaatgctgcccatcgttgataggccggtgattcattacgtggtt
gaggaggcagtgaaggcgggtatagaggacattctgataattactggaaaggggaagagg
gcgattgaggattactttgacaggagctttgagctggagtactatttaaaagagaggggg
aaactggaggcgttaagggaagtggaagaaatcggagaaatggtggatatttactacgtg
aggcagaaaaaacccctcggtttaggcgatgcaattctttacgctgagaagcacgtgaac
ggagaaccattcgccgtactcctgggagacgacataataatcagcaaaaaaccagcaata
aaacaactaattgaggttgcagaaagaaaaaacactccagttatcggtgtggagagtgtt
ccaagggagcttgtgagtagatatggaatcatagagggcgagctaattgaaaatgatctg
tataggataaagcgtctcgttgagaagccttcccctaaagaagcaccaagcaatattgca
ataattgggaggtacattttaattcctgagatatttgatatcctgagggagaccccacct
ggaagagatggagagatacagcttacagacgccctccagatacttttgaacaagaatgaa
atccttgcaaaaagaattgaaggagaaagatatgacattggaagtaaattcggttttgtc
atggcaaatctaaaattgagcctcagaagagaagaattaagaaatgaagtattgaaatac
ctaaaaagtattttgaaggagatctcaaatgagtag

DBGET integrated database retrieval system