KEGG   Pyrococcus abyssi: PAB0798Help
Entry
PAB0798           CDS       T00024                                 

Gene name
for
Definition
formaldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pab  Pyrococcus abyssi
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pab01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pab00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1158299..1160164
Genome map
AA seq 621 aa AA seqDB search
MKGWWGRILRVNLTTGEVKVQEYPEEVAKKFIGGRGLAAWILWNEVKGVDPLSPENKLVF
AAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVEGKAKKPVY
IYIEDDNVSILSAEGLWGKGTFETERELKKIHGKNVGILSIGPAGENLVKFAVVMSQEGR
AAGRPGMGAVMGSKKLKAVVIKGSKDIPVADKEELKKLSGEAYNDILNAPGYPFWKRQGT
MAAVEWTNENSALPTRNFSDGSFEFARSIDGYTMEGMKVKQRGCPYCNMPCGNVVLDAEG
QESELDYENVALLGANLGIGKLNEVAVLNRIADDMGMDTISLGGVIGFVMEAKEKGLIKD
DEAPEFGDFKKAKELALNIAYRRTELGNFAAEGVKRMAEKLGDDSFAMHVKGLEVSGYNC
FIYPAMALAYGTSSIGAHHKEAWVIAWEIGTAPIEGEQAKKVEYKITYDPVKAEKVVELQ
RLRGGLFEMLTACRLPWVEIGLSLEYYPKLLKAITGVTYTWDDLYKAADRIYALIRAYWV
REFNGNWGREMDYPPKRWFNEGLKSGPYKGQHLDREKYDALLSEYYRIRGWDERGIPTKE
TLKKLDLDFVIPELEKVTKLS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaagggatggtggggaaggattctaagggttaacctaacgaccggggaagttaaggtt
caggaataccctgaagaggtagcaaagaagttcataggaggtagaggtttagccgcctgg
attctgtggaacgaggtcaagggagttgatcctcttagcccagagaacaagctagttttc
gcggctggccccttcaacggattaccaacgccgagcggtggtaaattagtagttgccgcc
aagagcccacttactggaggttacggtgacggtaatttaggaactatggcctcagtccac
ctaaggagggcaggctacgacgctttagtggtagaagggaaggccaagaagccagtttac
atttacatagaggatgacaacgtaagcatactaagcgctgaaggtctatggggcaaggga
acctttgagactgagagggaactaaagaagatacacggaaagaacgttgggatactgagc
atagggccggctggagagaatctagtcaagttcgccgtggtaatgtcccaggagggaagg
gcagctggaaggcccggaatgggtgctgtaatgggaagcaagaagctcaaggcagttgtg
attaagggaagcaaggacatacctgttgccgacaaggaagagcttaagaagctgagcggg
gaagcttacaacgacatattaaacgccccaggatacccgttctggaagaggcaaggtacg
atggcggcagttgagtggacgaacgagaactcagcgttacctactagaaacttcagcgac
ggaagcttcgagttcgcccgttctatagacggttacaccatggagggaatgaaggtcaag
cagagaggttgtccgtactgtaacatgccatgtggaaacgtggttctagatgcagaaggc
caagaaagcgagctagactacgagaacgtcgctttgctaggtgcaaacctcgggataggg
aagctcaacgaggttgcagtccttaacaggatagcagatgacatgggtatggacaccata
agccttggcggggtcataggcttcgtcatggaggccaaggagaagggacttattaaggac
gatgaagctcctgaatttggagacttcaagaaggccaaggagctagctttaaacatagcc
tacagaagaactgaactaggtaacttcgcggccgagggagttaagaggatggccgaaaag
cttggagatgacagcttcgcaatgcacgtgaaggggctggaggttagcggttacaactgc
ttcatctacccggcgatggccctagcctatggaaccagctcaataggtgcccaccacaag
gaggcctgggtcatagcctgggagataggtacggcacctatagagggagagcaggcaaag
aaggttgagtacaagataacctacgatccagtaaaggctgagaaggtcgttgagttgcag
aggctgaggggtgggctcttcgagatgctaacggcctgtagattaccatgggttgagata
ggattaagcttggagtactatccaaagctactcaaggcgataactggagttacctacact
tgggacgacctttacaaggctgccgacaggatctacgcattgataagggcctactgggtc
agggaattcaacgggaactggggaagagagatggattatccaccgaagaggtggttcaac
gaaggattgaagagtggcccctacaagggccagcacttggacagggagaagtacgatgca
ctactctcagagtactacaggataaggggatgggacgagaggggaataccaaccaaggag
accctcaagaagctcgacttagatttcgttatcccagagctcgagaaggttacgaagctt
tcttaa

DBGET integrated database retrieval system