KEGG   Pyrococcus abyssi: PAB1208Help
Entry
PAB1208           CDS       T00024                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pab  Pyrococcus abyssi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAB1208
   01230 Biosynthesis of amino acids
    PAB1208
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1208
   00051 Fructose and mannose metabolism
    PAB1208
   00562 Inositol phosphate metabolism
    PAB1208
Enzymes [BR:pab01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAB1208
Exosome [BR:pab04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAB1208
  Exosomal proteins of bladder cancer cells
   PAB1208
  Exosomal proteins of melanoma cells
   PAB1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1712660..1713346)
Genome map
AA seq 228 aa AA seqDB search
MELKEPIIAINFKTYIEATGKRALEIAKAAERVWKDTGVTIVVAPQLVDLRMIAENVEIP
VFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAISRAKEVGLITM
VCSNNPAVSAAVAALDPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVRKVNPKVKVLC
GAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIRDLVSGIIRKD
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggagcttaaggaaccaataattgctataaattttaagacgtacatagaggctactgga
aagagggcccttgagatagcaaaggccgctgagagggtttggaaggacacgggagtgaca
atagtggttgcccctcagctcgttgatcttaggatgatagctgagaacgttgagattcca
gtttttgcccagcacatagatcccataaagcccggaagtcacactggccatgttctcccc
gaagctgtaaaggaggctggagccgttggaactttgcttaaccactcggagaacaggatg
atacttgcagaccttgaggccgcaatatctagggccaaggaagttgggctcataacgatg
gtatgctcgaacaatccagcggtaagtgcggctgtagcagctctagaccctgactacgtt
gcagttgagcctccagagttaatcggaactggtattccggttagcaaggccaagccggag
gttataactgataccgttgaactcgtgaggaaggtgaacccgaaggttaaagttctttgt
ggggctggaattagcacgggagaggatgttaagaaagctatagagcttggaacagtcgga
gttttgctggcgagtggcgttacaaaggcaaaagatccagaaaaggccataagggatttg
gtttcaggaataataagaaaagattag

DBGET integrated database retrieval system