KEGG   Pyrococcus abyssi: PAB1208Help
Entry
PAB1208           CDS       T00024                                 

Definition
(GenBank) tpiA triosephosphate isomerase, archaeal triose phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pab  Pyrococcus abyssi
Pathway
pab00010  Glycolysis / Gluconeogenesis
pab00051  Fructose and mannose metabolism
pab00562  Inositol phosphate metabolism
pab01100  Metabolic pathways
pab01110  Biosynthesis of secondary metabolites
pab01120  Microbial metabolism in diverse environments
pab01130  Biosynthesis of antibiotics
pab01200  Carbon metabolism
pab01230  Biosynthesis of amino acids
Module
pab_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pab_M00002  Glycolysis, core module involving three-carbon compounds
pab_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1208
   00051 Fructose and mannose metabolism
    PAB1208
   00562 Inositol phosphate metabolism
    PAB1208
Enzymes [BR:pab01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAB1208
Exosome [BR:pab04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAB1208
  Exosomal proteins of bladder cancer cells
   PAB1208
  Exosomal proteins of melanoma cells
   PAB1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS DHO_dh His_biosynth B12-binding NanE
Motif
Other DBs
NCBI-ProteinID: CAB50641
UniProt: Q9UXX2
Position
complement(1712660..1713346)
Genome map
AA seq 228 aa AA seqDB search
MELKEPIIAINFKTYIEATGKRALEIAKAAERVWKDTGVTIVVAPQLVDLRMIAENVEIP
VFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAISRAKEVGLITM
VCSNNPAVSAAVAALDPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVRKVNPKVKVLC
GAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIRDLVSGIIRKD
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggagcttaaggaaccaataattgctataaattttaagacgtacatagaggctactgga
aagagggcccttgagatagcaaaggccgctgagagggtttggaaggacacgggagtgaca
atagtggttgcccctcagctcgttgatcttaggatgatagctgagaacgttgagattcca
gtttttgcccagcacatagatcccataaagcccggaagtcacactggccatgttctcccc
gaagctgtaaaggaggctggagccgttggaactttgcttaaccactcggagaacaggatg
atacttgcagaccttgaggccgcaatatctagggccaaggaagttgggctcataacgatg
gtatgctcgaacaatccagcggtaagtgcggctgtagcagctctagaccctgactacgtt
gcagttgagcctccagagttaatcggaactggtattccggttagcaaggccaagccggag
gttataactgataccgttgaactcgtgaggaaggtgaacccgaaggttaaagttctttgt
ggggctggaattagcacgggagaggatgttaagaaagctatagagcttggaacagtcgga
gttttgctggcgagtggcgttacaaaggcaaaagatccagaaaaggccataagggatttg
gtttcaggaataataagaaaagattag

DBGET integrated database retrieval system