KEGG   Pyrococcus abyssi: PAB1315Help
Entry
PAB1315           CDS       T00024                                 

Definition
glyceraldehyde-3-phosphate: ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pab  Pyrococcus abyssi
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAB1315
   01230 Biosynthesis of amino acids
    PAB1315
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1315
Enzymes [BR:pab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     PAB1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1537163..1539124)
Genome map
AA seq 653 aa AA seqDB search
MKFSVLKIDVEKKDIKLEDFEREDIYGIIDYGIYVHTQLKTYELEPYDPRNVMIIGKGPF
AGSALPGSHRLVFFYRSPLYGTLFPSTMGGASYQFQHVGVDFVEIHGKAEKPVVIIMKND
GEEISVNFYELEMDKLIEIWEGYKGEEGVYALTQYLLDNLSSEFEGMEFRIAVVGPAALN
TNYGAVFSQALRNGKRAVGSEDWAARGGTGSVLLRAHNVVAIAFGGKKRKKKFPGEDITS
MSTAKRIVEGVHKKPYNEVVTHATTKYRFNPKLNTGGTFGGNYPAEGELVPILNWQMPYI
PKEERIKIHELIMKYYWEPFNEESIKPKKWTTCGEPCPAVCKKHRRGHHVEYEPYEANGP
LSGSIYLYASDISVHAVDSMGFDAIEFGGTAAWLLELVYRGLLKPEEVGISDKPRFSKDD
LINNPKETSEHNAKLVAELAHVIAFAKTEIARIAGLGKRKASMILDEKFKDRLKYGESFK
DYAVYTPLGEDGEINPTMYWAIGNYIPLPIQGRYWTFYAFGTFLEPEELASKIVSSALWE
FWYDNIGWCRFHRGWVKQTLRALFMEAYGVNVDMEEHARKQIRKLIDYAKRAGYIPVFWD
SMRVIDLVAKGSEEFGNENWAKKFKEDKIRAAKEYLKRVLEAYSKLMGVDWTI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctcagtactaaagatcgacgtggaaaagaaagatatcaagcttgaagacttt
gaaagggaagacatttatggaattatagattatggaatctacgttcacacacagctaaaa
acctacgagctcgagccgtacgatccgaggaatgtcatgataatcggtaaaggaccgttt
gcaggttccgccttgccaggttctcataggttggtcttcttctataggtcaccactttat
gggacacttttcccttcaacgatgggaggtgcgagctatcaattccagcacgttggcgta
gacttcgttgagatccacggaaaggccgagaagcccgtggtcattataatgaagaacgat
ggtgaggagataagtgttaacttctacgagcttgagatggataagttgatcgagatatgg
gaagggtacaagggagaagagggcgtctacgccttaacccagtacctccttgataacctt
tcaagtgaattcgagggaatggaattcaggatagctgttgtagggcctgcggctttgaac
acgaactatggggccgtcttttctcaagccttgaggaacggaaagagggccgtgggaagc
gaggactgggccgctaggggcggaactgggagcgtcttgcttagggcccacaacgtcgtt
gccatagcctttggaggtaagaagaggaagaagaagttccctggggaagacataactagc
atgtcaacggccaagaggatcgtggaaggagttcacaagaagccgtacaacgaggttgta
acccatgcaactaccaagtacaggtttaatccaaagctcaacaccggtggaacttttgga
ggtaactatcctgccgagggagagctagtcccaattctaaactggcagatgccctacata
cccaaagaagaaagaataaagatacacgagctcataatgaagtactactgggaacccttc
aacgaggaatccataaagccgaagaagtggactacctgcggtgagccctgtccggccgtg
tgtaagaagcataggagaggacaccacgttgagtacgagccttacgaagcgaatggtcca
cttagcgggagtatctatctgtatgcgagcgacataagcgttcatgccgtagattctatg
ggcttcgacgctatagaatttggaggcacagcagcttggctcttagagctcgtttacaga
ggattgcttaagcccgaggaggttgggataagcgacaagccaaggttcagtaaggatgat
ctaataaacaatccaaaggagactagtgaacacaatgctaagctagtggccgagcttgcc
cacgttatagctttcgccaagactgaaattgccagaatagccggactaggaaagagaaag
gctagcatgatcttagatgagaagttcaaggataggttgaagtacggtgagagcttcaag
gactatgccgtttacactcccctcggtgaggatggcgagataaacccaacgatgtactgg
gcaattggaaattacattcccttaccaatccaggggagatactggacgttctatgccttt
ggaacgttcctggagccagaggagctggcgagtaagatagtttcatcggcgctctgggag
ttctggtacgataacatcggctggtgcaggttccacaggggttgggttaagcaaacgttg
agggctctcttcatggaagcttacggagttaacgttgatatggaagagcacgccaggaag
cagataaggaagcttatagactacgccaagagggcaggttacatcccagtgttctgggat
agcatgagggtgatagatctagtagccaaggggagcgaagaatttggaaatgagaactgg
gccaagaagttcaaggaagataaaattagggccgctaaggagtaccttaagagggtcttg
gaagcttacagcaaacttatgggtgtggattggacgatttaa

DBGET integrated database retrieval system