KEGG   Pyrococcus abyssi: PAB1315Help
Entry
PAB1315           CDS       T00024                                 

Definition
(GenBank) gor glyceraldehyde-3-phosphate: ferredoxin oxidoreductase
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pab  Pyrococcus abyssi
Pathway
pab00010  Glycolysis / Gluconeogenesis
pab01100  Metabolic pathways
pab01120  Microbial metabolism in diverse environments
pab01200  Carbon metabolism
pab01230  Biosynthesis of amino acids
Module
pab_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pab_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1315
Enzymes [BR:pab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     PAB1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: CAB50484
UniProt: Q9UYC8
Position
complement(1537163..1539124)
Genome map
AA seq 653 aa AA seqDB search
MKFSVLKIDVEKKDIKLEDFEREDIYGIIDYGIYVHTQLKTYELEPYDPRNVMIIGKGPF
AGSALPGSHRLVFFYRSPLYGTLFPSTMGGASYQFQHVGVDFVEIHGKAEKPVVIIMKND
GEEISVNFYELEMDKLIEIWEGYKGEEGVYALTQYLLDNLSSEFEGMEFRIAVVGPAALN
TNYGAVFSQALRNGKRAVGSEDWAARGGTGSVLLRAHNVVAIAFGGKKRKKKFPGEDITS
MSTAKRIVEGVHKKPYNEVVTHATTKYRFNPKLNTGGTFGGNYPAEGELVPILNWQMPYI
PKEERIKIHELIMKYYWEPFNEESIKPKKWTTCGEPCPAVCKKHRRGHHVEYEPYEANGP
LSGSIYLYASDISVHAVDSMGFDAIEFGGTAAWLLELVYRGLLKPEEVGISDKPRFSKDD
LINNPKETSEHNAKLVAELAHVIAFAKTEIARIAGLGKRKASMILDEKFKDRLKYGESFK
DYAVYTPLGEDGEINPTMYWAIGNYIPLPIQGRYWTFYAFGTFLEPEELASKIVSSALWE
FWYDNIGWCRFHRGWVKQTLRALFMEAYGVNVDMEEHARKQIRKLIDYAKRAGYIPVFWD
SMRVIDLVAKGSEEFGNENWAKKFKEDKIRAAKEYLKRVLEAYSKLMGVDWTI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctcagtactaaagatcgacgtggaaaagaaagatatcaagcttgaagacttt
gaaagggaagacatttatggaattatagattatggaatctacgttcacacacagctaaaa
acctacgagctcgagccgtacgatccgaggaatgtcatgataatcggtaaaggaccgttt
gcaggttccgccttgccaggttctcataggttggtcttcttctataggtcaccactttat
gggacacttttcccttcaacgatgggaggtgcgagctatcaattccagcacgttggcgta
gacttcgttgagatccacggaaaggccgagaagcccgtggtcattataatgaagaacgat
ggtgaggagataagtgttaacttctacgagcttgagatggataagttgatcgagatatgg
gaagggtacaagggagaagagggcgtctacgccttaacccagtacctccttgataacctt
tcaagtgaattcgagggaatggaattcaggatagctgttgtagggcctgcggctttgaac
acgaactatggggccgtcttttctcaagccttgaggaacggaaagagggccgtgggaagc
gaggactgggccgctaggggcggaactgggagcgtcttgcttagggcccacaacgtcgtt
gccatagcctttggaggtaagaagaggaagaagaagttccctggggaagacataactagc
atgtcaacggccaagaggatcgtggaaggagttcacaagaagccgtacaacgaggttgta
acccatgcaactaccaagtacaggtttaatccaaagctcaacaccggtggaacttttgga
ggtaactatcctgccgagggagagctagtcccaattctaaactggcagatgccctacata
cccaaagaagaaagaataaagatacacgagctcataatgaagtactactgggaacccttc
aacgaggaatccataaagccgaagaagtggactacctgcggtgagccctgtccggccgtg
tgtaagaagcataggagaggacaccacgttgagtacgagccttacgaagcgaatggtcca
cttagcgggagtatctatctgtatgcgagcgacataagcgttcatgccgtagattctatg
ggcttcgacgctatagaatttggaggcacagcagcttggctcttagagctcgtttacaga
ggattgcttaagcccgaggaggttgggataagcgacaagccaaggttcagtaaggatgat
ctaataaacaatccaaaggagactagtgaacacaatgctaagctagtggccgagcttgcc
cacgttatagctttcgccaagactgaaattgccagaatagccggactaggaaagagaaag
gctagcatgatcttagatgagaagttcaaggataggttgaagtacggtgagagcttcaag
gactatgccgtttacactcccctcggtgaggatggcgagataaacccaacgatgtactgg
gcaattggaaattacattcccttaccaatccaggggagatactggacgttctatgccttt
ggaacgttcctggagccagaggagctggcgagtaagatagtttcatcggcgctctgggag
ttctggtacgataacatcggctggtgcaggttccacaggggttgggttaagcaaacgttg
agggctctcttcatggaagcttacggagttaacgttgatatggaagagcacgccaggaag
cagataaggaagcttatagactacgccaagagggcaggttacatcccagtgttctgggat
agcatgagggtgatagatctagtagccaaggggagcgaagaatttggaaatgagaactgg
gccaagaagttcaaggaagataaaattagggccgctaaggagtaccttaagagggtcttg
gaagcttacagcaaacttatgggtgtggattggacgatttaa

DBGET integrated database retrieval system