KEGG   Pyrococcus abyssi: PAB1474Help
Entry
PAB1474           CDS       T00024                                 

Gene name
porD
Definition
pyuvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
pab  Pyrococcus abyssi
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pab01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pab00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pab00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pab00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pab00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pab00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:pab00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1321730..1322047)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERAQKELTEKMTPGAIAYIPGSSVINKTGSWRVFRPEFKKDKCVRCFLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTNAIEMVREVK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagtccgtttaaagccgatatcgagagggcacaaaaagagttgactgaaaaa
atgaccccaggagcaatagcttacatccctgggagtagcgtaattaacaagaccggttct
tggagagttttcaggccagagtttaagaaggacaagtgcgtaaggtgcttcctgtgctac
atctactgcccagagcctgccatatacttggacgaagagggctacccagttttcgactat
gactattgtaagggttgtggtatatgcgctaacgaatgcccaaccaacgctatagagatg
gttagagaggttaagtga

DBGET integrated database retrieval system