KEGG   Pyrococcus abyssi: PAB1474Help
Entry
PAB1474           CDS       T00024                                 

Definition
(GenBank) porD pyruvate synthase subunit porD (EC 1.2.7.1) (pyruvate oxidoreductase delta chain) (pyruvate ferredoxin oxidoreductase)
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
pab  Pyrococcus abyssi
Pathway
pab00010  Glycolysis / Gluconeogenesis
pab00020  Citrate cycle (TCA cycle)
pab00620  Pyruvate metabolism
pab00640  Propanoate metabolism
pab00650  Butanoate metabolism
pab00680  Methane metabolism
pab00720  Carbon fixation pathways in prokaryotes
pab01100  Metabolic pathways
pab01120  Microbial metabolism in diverse environments
pab01130  Biosynthesis of antibiotics
pab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1474
   00020 Citrate cycle (TCA cycle)
    PAB1474
   00620 Pyruvate metabolism
    PAB1474
   00640 Propanoate metabolism
    PAB1474
   00650 Butanoate metabolism
    PAB1474
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAB1474
   00680 Methane metabolism
    PAB1474
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAB1474
Enzymes [BR:pab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAB1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_16 Fer4_9 Fer4_10 Fer4_17 Fer4_4 Fer4_22 Fer4_8 Fer4_15 RPAP1_N
Motif
Other DBs
NCBI-ProteinID: CAB50269
UniProt: Q9UYZ3
Position
complement(1321730..1322047)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERAQKELTEKMTPGAIAYIPGSSVINKTGSWRVFRPEFKKDKCVRCFLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTNAIEMVREVK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagtccgtttaaagccgatatcgagagggcacaaaaagagttgactgaaaaa
atgaccccaggagcaatagcttacatccctgggagtagcgtaattaacaagaccggttct
tggagagttttcaggccagagtttaagaaggacaagtgcgtaaggtgcttcctgtgctac
atctactgcccagagcctgccatatacttggacgaagagggctacccagttttcgactat
gactattgtaagggttgtggtatatgcgctaacgaatgcccaaccaacgctatagagatg
gttagagaggttaagtga

DBGET integrated database retrieval system